DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Rme-8

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_610467.1 Gene:Rme-8 / 35939 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster


Alignment Length:289 Identity:52/289 - (17%)
Similarity:101/289 - (34%) Gaps:123/289 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLCTTSYI-HVCSS-------LNDP---------------------------YAILGIN----KK 40
            :.|...|: |:|.:       ::||                           |..|||:    .|
  Fly  1252 LFCHIYYLRHLCDTQKFPNWPISDPVQLLKHTLDAWRKEVEKKPPQMTIQQAYQDLGIDLTKTPK 1316

  Fly    41 ATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLD------------------RR 87
            .....||::|.:||:.:|||  ||..|.|.|.::..|||.|...:                  :.
  Fly  1317 PDESMIRKSYYKLAQMYHPD--KNPNGREIFEKVNQAYEFLCSRNVWSSGGPDPNNIVLILRTQS 1379

  Fly    88 RIFDRYGVSDINSQYFQKKHDYSEYNRF--TLNQNDDDFGQRFDIKQDIAFYQKLSITENYFEKM 150
            .:|:||  .|:...|     .|:.|.:.  |:         |.:.:.|..|              
  Fly  1380 ILFERY--PDVLRPY-----KYAGYPQLIKTI---------RLETRDDELF-------------- 1414

  Fly   151 ILSKNAKKVHVVMFYNDWCF---KCT--------------RIVDAFKKILELL----QPIGINFA 194
                 :|:..::...::.|:   .|:              .:::|:.:.:.:|    :|..:::.
  Fly  1415 -----SKEAQLLTAASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDSKPDSLHYQ 1474

  Fly   195 TVNAV----HEESVFRKCGAR--EVPQLV 217
            .::.|    .....|.||..:  ::|||:
  Fly  1475 VISNVTRCFEVACNFEKCKQKIIQLPQLL 1503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 26/112 (23%)
DnaJ 30..91 CDD:278647 24/109 (22%)
TRX_DnaJ 134..244 CDD:239261 14/111 (13%)
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937
DnaJ 1304..1356 CDD:278647 21/53 (40%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.