DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc21

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_956338.1 Gene:dnajc21 / 336984 ZFINID:ZDB-GENE-030131-8928 Length:545 Species:Danio rerio


Alignment Length:250 Identity:62/250 - (24%)
Similarity:107/250 - (42%) Gaps:76/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKN-DYGAEKFIQIKLAYEILADLDRRRIFDRY- 93
            |.:||:.:.|:..::::||::||.|||||| :.| :..||:|..|:.||::|:|...|..:|.: 
Zfish     5 YEVLGVKRDASDDDLKKAYRKLALKWHPDKNLDNAEDAAEQFKLIQAAYDVLSDPQERAWYDNHR 69

  Fly    94 ------GVSDINSQYFQKKHDYSEYNRFTL----NQNDDDFGQRFDIKQDIAFYQKLSITENYFE 148
                  |||   .:|.....|..::  ||:    ...||:.|          ||   ::..|.||
Zfish    70 EALLKGGVS---GEYQDDSIDLVQF--FTVTCYSGYGDDEKG----------FY---AVYRNVFE 116

  Fly   149 KMILSKNAKKVH------------------------VVMFYNDWCFKCTRIVDAFKKILELLQPI 189
            .::   ..:|.|                        |.:||..|...|||...|:|:..:..|  
Zfish   117 SIV---KEEKEHSKDEEDEEDEFPSFGESESDYDTVVHLFYGYWQSFCTRKNFAWKEEYDTRQ-- 176

  Fly   190 GINFATVNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDHSFTPQKVVEFIRKK 244
            ..|.....|:.:|:...:..||                ::|:...:::|.|:||:
Zfish   177 ASNRWEKRAMEKENKKTRDKAR----------------KEHNELVRQLVAFVRKR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 25/70 (36%)
DnaJ 30..91 CDD:278647 24/60 (40%)
TRX_DnaJ 134..244 CDD:239261 26/133 (20%)
dnajc21NP_956338.1 DnaJ 3..66 CDD:278647 24/60 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..141 2/18 (11%)
DBINO <183..246 CDD:290603 9/48 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..302
zf-C2H2_jaz 323..348 CDD:288983
C2H2 Zn finger 325..347 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 331..497
C2H2 Zn finger 500..522 CDD:275371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.