DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnaja3a

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_005168528.1 Gene:dnaja3a / 335894 ZFINID:ZDB-GENE-030131-7837 Length:475 Species:Danio rerio


Alignment Length:225 Identity:65/225 - (28%)
Similarity:99/225 - (44%) Gaps:46/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VLCTTSYIHVC--SSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA-EKFIQIKL 76
            |:|..|: |..  |...|.|.|||:.:.||..||::||.::|||:|||..|.|..| |||.|:..
Zfish    75 VVCKMSF-HTSAPSRKQDFYQILGVPRSATQKEIKKAYYQMAKKYHPDTNKEDPQAKEKFAQLAE 138

  Fly    77 AYEILADLDRRRIFDRYGVSDINS--------QY------------FQKKHDYSEYNRFTLNQND 121
            |||:|:|..:|:.:|.||.:..::        ||            |:|     .:..|:..|..
Zfish   139 AYEVLSDEVKRKQYDTYGSAGFDAGRAGAGHQQYWGGGTSIDPEELFRK-----IFGEFSGAQGF 198

  Fly   122 DDFGQRFDIKQDIAFYQKLSITENYFEKMILSKNAKKVH--VVMFYNDWCFKCT-RIVDAFKKIL 183
            .||...|:..|:            |..::..::.||.|:  :.:.....|.:|. |..:...|:.
Zfish   199 GDFNAIFNQPQE------------YVMELTFAQAAKGVNKEITVNIEGTCQRCDGRGHEPGSKVQ 251

  Fly   184 ELLQPIGINFATVNA--VHEESVFRKCGAR 211
            ......|....|||.  ....|..|:||.|
Zfish   252 HCGNCNGTGMETVNTGPFVMRSTCRRCGGR 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 31/64 (48%)
DnaJ 30..91 CDD:278647 30/61 (49%)
TRX_DnaJ 134..244 CDD:239261 17/83 (20%)
dnaja3aXP_005168528.1 DnaJ 89..474 CDD:223560 60/210 (29%)
DnaJ 91..153 CDD:278647 30/61 (49%)
DnaJ_C 207..416 CDD:199909 18/87 (21%)
DnaJ_zf 236..296 CDD:199908 13/46 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.