DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and shv

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_608525.1 Gene:shv / 33220 FlyBaseID:FBgn0031256 Length:354 Species:Drosophila melanogaster


Alignment Length:172 Identity:55/172 - (31%)
Similarity:86/172 - (50%) Gaps:28/172 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MISCLISNYIITI-LVLCTTSYIHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKN 64
            :|.||:   ||.: |:|...|:     :..|.|.||.:.|.|.|.|:::||:.|||:.||||.|:
  Fly     3 LIKCLV---IIQLSLLLVEESF-----AGRDFYKILNVKKNANTNEVKKAYRRLAKELHPDKNKD 59

  Fly    65 DYGAE-KFIQIKLAYEILADLDRRRIFDRYGVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRF 128
            |..|. ||..:..|||:|::.|:|:.:||.|...:      ||....::.....:....|||..|
  Fly    60 DPDASTKFQDLGAAYEVLSNPDKRKTYDRCGEECL------KKEGMMDHGGDPFSSFFGDFGFHF 118

  Fly   129 --DIKQ-------DIAFYQKLSITENY---FEKMILSKNAKK 158
              |.:|       ||.....:|:.|.|   |.:::.:|...|
  Fly   119 GGDGQQQDAPRGADIVMDLYVSLEELYSGNFVEIVRNKPVTK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 30/64 (47%)
DnaJ 30..91 CDD:278647 28/61 (46%)
TRX_DnaJ 134..244 CDD:239261 7/28 (25%)
shvNP_608525.1 DnaJ 22..346 CDD:223560 47/145 (32%)
DnaJ 25..87 CDD:278647 28/61 (46%)
DnaJ_C 131..328 CDD:199909 8/30 (27%)
DnaJ_zf 160..>195 CDD:304418 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.