DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and CG7872

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster


Alignment Length:354 Identity:73/354 - (20%)
Similarity:131/354 - (37%) Gaps:118/354 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ITILVLCTTSYIHVCSSL----NDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAE-- 69
            :.:|.|..|..:.:...|    .:.|.:||:.::::..||.:||::||:::|||..:   |||  
  Fly     8 LVLLALLPTMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHR---GAEAK 69

  Fly    70 -----KFIQIKLAYEILADLDRRRIFDRYGVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQRFD 129
                 :|..:..|||||.|.:.|..:| |.:.:.::.|   .|.|..|.|            |..
  Fly    70 AAAETQFKLVATAYEILRDEESRTDYD-YMLDNPDAYY---AHYYRYYRR------------RVA 118

  Fly   130 IKQDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDW-----CFKCTRIVDAFK--------- 180
            .|.|:              ::::......|.|:.:|:.|     ..|....|..::         
  Fly   119 PKVDV--------------RVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARD 169

  Fly   181 KILELLQPIGINFATVNAVHE--ESVFRKC--------GAREVP--------QLVL----IL--- 220
            :|.|.:|..|.|..:.|...:  |.:.|:.        |....|        ||::    ||   
  Fly   170 EIQEKIQKKGKNRMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFI 234

  Fly   221 -------------------DNQYFLYR------DHSFTPQK---VVEFIRKKIPFNVFKRIEHDN 257
                               :.:.:|.|      .|.|..|:   :.|::..|:    :||   :|
  Fly   235 VWHAQWFWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKL----WKR---EN 292

  Fly   258 FNDFLGGWSDNRARALIFEPRSLTRLRYL 286
            |..:.....:...:.|...||.....||:
  Fly   293 FVAWKAEQEEEMKKKLAENPRYKAYRRYM 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 24/70 (34%)
DnaJ 30..91 CDD:278647 23/67 (34%)
TRX_DnaJ 134..244 CDD:239261 26/176 (15%)
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 23/67 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464407
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.