DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_997842.1 Gene:dnajc4 / 324373 ZFINID:ZDB-GENE-030131-3093 Length:237 Species:Danio rerio


Alignment Length:216 Identity:46/216 - (21%)
Similarity:86/216 - (39%) Gaps:50/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCTTSYIHVCS------------SLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA 68
            ||.|.:.:..|            |..:.|.:||:...||..:|:.|:.:.:||.|||...::.|.
Zfish     9 LCQTCFWYCRSSQRLFSLSAAHRSQTNYYELLGVKPDATLEQIKFAFFDKSKKLHPDSDPSNPGL 73

  Fly    69 E-KFIQIKLAYEILADLDRRRIFD-------------RYGVSDINSQYFQKKHDYSEYNRFTLNQ 119
            . :|:|:..||.:|:....|:.:|             |...|..|:..::.......:.:|...|
Zfish    74 HTQFVQLNEAYRVLSKEGSRQDYDLRLRYQYAGGQAFRTSSSSSNNPSWEANESMRYWEQFRQAQ 138

  Fly   120 NDDDFGQRFDIKQDIAFYQKLSITENYFEKMILSKNA--------KKVH----------VVMFYN 166
            ..::..:..:.|:.    :.:.:....|..||||.:|        ::||          :...||
Zfish   139 PQENTPEEREKKKK----RNMRLVGYCFLAMILSVSAHYFGFRKLEEVHNNFMDEKDRVITKIYN 199

  Fly   167 DWCFKCTRIVDAFKKILELLQ 187
            :  .|.....:..||..|:|:
Zfish   200 E--SKERARANGIKKQQEILR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 21/77 (27%)
DnaJ 30..91 CDD:278647 19/61 (31%)
TRX_DnaJ 134..244 CDD:239261 15/72 (21%)
dnajc4NP_997842.1 DnaJ 35..97 CDD:278647 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592334
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.