DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajc5ga

DIOPT Version :10

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_955917.1 Gene:dnajc5ga / 322863 ZFINID:ZDB-GENE-030131-1583 Length:199 Species:Danio rerio


Alignment Length:81 Identity:33/81 - (40%)
Similarity:49/81 - (60%) Gaps:3/81 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYGV 95
            |.:||:.|.||..:|:.||::||.|:|||| ..|...||||.:|..|..||.|..:|:|:|.||.
Zfish    23 YKVLGLEKGATAEDIKRAYRKLALKYHPDKNPDNPEAAEKFKEINNANSILTDETKRKIYDEYGS 87

  Fly    96 SD--INSQYFQKKHDY 109
            ..  ::.|:.::...|
Zfish    88 MGLYVSEQFGEESVKY 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:440252 29/62 (47%)
TRX_DnaJ 134..244 CDD:239261
dnajc5gaNP_955917.1 DnaJ 21..83 CDD:395170 28/59 (47%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.