DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnaja4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001020582.1 Gene:Dnaja4 / 300721 RGDID:1310035 Length:555 Species:Rattus norvegicus


Alignment Length:282 Identity:72/282 - (25%)
Similarity:109/282 - (38%) Gaps:88/282 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYGVS 96
            |.|||:...|:..||::||::||.|:|||  ||....|||..|..|||:|:|..:|.|:|:.|..
  Rat   166 YDILGVKPSASPEEIKKAYRKLALKYHPD--KNPDEGEKFKLISQAYEVLSDPKKRDIYDQGGEQ 228

  Fly    97 DI-----NSQYFQKKHD-----YSEYNRFTLNQNDDDFGQRFDIK-QDI--AFYQKLSITENYF- 147
            .|     .|..|....|     :....|.|..:...:...:..:. :|:  ...:||::.:|.. 
  Rat   229 AIKEGGSGSPSFSSPMDIFDMFFGGGGRMTRERRGKNVVHQLSVTLEDLYNGITKKLALQKNIIC 293

  Fly   148 -------------EKMILSK-NAKKVHV-------VMFYNDWCFKC----TRI------------ 175
                         ||..|.| ...::|:       |......|.:|    .||            
  Rat   294 EKCEGIGGKKGSVEKCPLCKGRGMQIHIQQIGPGMVQQIQTVCIECKGQGERINPKDRCEDCSGA 358

  Fly   176 -VDAFKKILELLQPIGINFATVNAVHEESVFRKCGAREVPQL-----VLILDNQYFLYRDHSFTP 234
             |...|||:|:....|:........|.|      |.:| |:|     :::||.     :|||   
  Rat   359 KVTREKKIIEVHVDKGMKDGQKILFHGE------GDQE-PELEPGDVIIVLDQ-----KDHS--- 408

  Fly   235 QKVVEFIRKKIPFNVFKRIEHD 256
                          ||:|..||
  Rat   409 --------------VFQRRGHD 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 29/61 (48%)
DnaJ 30..91 CDD:278647 28/58 (48%)
TRX_DnaJ 134..244 CDD:239261 30/155 (19%)
Dnaja4NP_001020582.1 PTZ00037 144..552 CDD:240236 72/282 (26%)
DnaJ 165..223 CDD:278647 28/58 (48%)
DnaJ_C 264..490 CDD:199909 36/182 (20%)
DnaJ_zf 293..359 CDD:199908 10/65 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.