DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc18

DIOPT Version :10

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001385532.1 Gene:Dnajc18 / 291677 RGDID:1310237 Length:357 Species:Rattus norvegicus


Alignment Length:143 Identity:33/143 - (23%)
Similarity:59/143 - (41%) Gaps:52/143 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG-- 94
            |.|||::..|:..|:::|||:||.|:||||.......:.|..|..|:.:|::.|:|..:|.||  
  Rat    84 YDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYGDE 148

  Fly    95 ----------------------------------------------VSDINSQYFQKKHDYSEYN 113
                                                          |:| :|.|::::|   .:.
  Rat   149 QVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHFPSGNIHMFSNVTD-DSHYYRRRH---RHE 209

  Fly   114 RFTLNQNDDDFGQ 126
            |...::.::|..|
  Rat   210 RTQAHKREEDKSQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:440252 23/61 (38%)
TRX_DnaJ 134..244 CDD:239261
Dnajc18NP_001385532.1 PRK14298 81..>182 CDD:184612 25/97 (26%)
DUF1977 249..347 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.