DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and Dnajc18

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	XP_006254608.1	Gene:	Dnajc18 / 291677	RGDID:	1310237	Length:	357	Species:	Rattus norvegicus

Alignment Length:	143	Identity:	33/143 - (23%)
Similarity:	59/143 - (41%)	Gaps:	52/143 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG-- 94
            |.|||::..|:..|:::|||:||.|:||||.......:.|..|..|:.:|::.|:|..:|.||
  Rat    84 YDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATDAFKAIGNAFAVLSNPDKRLRYDEYGDE 148

  Fly    95 ----------------------------------------------VSDINSQYFQKKHDYSEYN 113
                                                          |:| :|.|::::|   .:.
  Rat   149 QVTLTAPRARPYHYYRDVEADISPEELFNVFFGGHFPSGNIHMFSNVTD-DSHYYRRRH---RHE 209

  Fly   114 RFTLNQNDDDFGQ 126
            |...::.::|..|
  Rat   210 RTQAHKREEDKSQ 222

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	23/61 (38%)
		DnaJ	30..91	CDD:278647	22/58 (38%)
		TRX_DnaJ	134..244	CDD:239261
Dnajc18	XP_006254608.1	DnaJ	82..143	CDD:278647	22/58 (38%)
Dnajc18	XP_006254608.1	DUF1977	250..349	CDD:286411
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166350629
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.840