DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc2

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_033610.1 Gene:Dnajc2 / 22791 MGIID:99470 Length:621 Species:Mus musculus


Alignment Length:180 Identity:50/180 - (27%)
Similarity:74/180 - (41%) Gaps:28/180 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILG---INKKATTYEIREAYKELAKKWHPDKVK----------NDYGAEKFIQIKLAYEIL 81
            |.||:||   :...||..:|:.|:|.:..|.||||.|          |||    |..|..|||:|
Mouse    88 DHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDY----FTCITKAYEML 148

  Fly    82 ADLDRRRIFDRY---------GVSDINSQYFQKKHDYSEYN-RFTLNQNDDDFGQRFDIKQDI-A 135
            :|..:||.|:..         ..|:....:||......|.| |::..:|....|......:|: |
Mouse   149 SDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSRWSNKKNVPKLGDMNSSFEDVDA 213

  Fly   136 FYQKLSITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVDAFKKILEL 185
            ||......:::.|...|.:..|:.........|..|..|...|.:|..|:
Mouse   214 FYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQRKKEEM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 29/85 (34%)
DnaJ 30..91 CDD:278647 28/73 (38%)
TRX_DnaJ 134..244 CDD:239261 12/53 (23%)
Dnajc2NP_033610.1 ZUO1 75..368 CDD:227594 50/180 (28%)
DnaJ 88..158 CDD:278647 28/73 (38%)
ZRF1-UBD 160..250 16/89 (18%)
RAC_head 349..420 CDD:293322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 422..453
SANT 452..508 CDD:197842
SANT 453..506 CDD:238096
SANT 552..602 CDD:197842
SANT 553..600 CDD:238096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847125
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.