DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnj-3

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_506711.1 Gene:dnj-3 / 182084 WormBaseID:WBGene00001021 Length:191 Species:Caenorhabditis elegans


Alignment Length:100 Identity:25/100 - (25%)
Similarity:48/100 - (48%) Gaps:29/100 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LISNYIITILVLCTTSYIHVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA- 68
            |.::|||.                .:.|.|:|::..||..|||:|:.:..|:.|||:.:....: 
 Worm     9 LFASYIIR----------------KNYYEIIGVSASATRQEIRDAFLKKTKQLHPDQSRKSSKSD 57

  Fly    69 ------------EKFIQIKLAYEILADLDRRRIFD 91
                        |:|:.:|.||::|.:.::|:.:|
 Worm    58 SRVGWATGSSETEQFMLVKEAYDVLRNEEKRKEYD 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 20/74 (27%)
DnaJ 30..91 CDD:278647 20/73 (27%)
TRX_DnaJ 134..244 CDD:239261
dnj-3NP_506711.1 DnaJ_bact 19..>92 CDD:274090 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.