DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnj-2

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_502126.1 Gene:dnj-2 / 178043 WormBaseID:WBGene00001020 Length:337 Species:Caenorhabditis elegans


Alignment Length:312 Identity:70/312 - (22%)
Similarity:109/312 - (34%) Gaps:99/312 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ILVLCTTSYIHVCSS----------LNDPYAILGINKKA-TTYEIREAYKELAKKWHPDKVKND- 65
            ||.|..:.::..|.|          |.:.|.:|.:|::. ...::.:||:.||:|.|||:|||. 
 Worm     9 ILFLLVSFFVQECESVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKE 73

  Fly    66 ---YGAEKFIQIKLAYEILADLDRRRIFDRYGVSDINSQYFQKKHDYSEYNRFTLNQNDDDFGQR 127
               ...|:|..|..|||.|.|.:.:..:|.|  .|...|.|   ::|.:|.|...       ..:
 Worm    74 EKLLAEERFRVIATAYETLKDDEAKTNYDYY--LDHPDQRF---YNYYQYYRLRA-------APK 126

  Fly   128 FDIK-------QDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVDAFKKILEL 185
            .|::       ..|:.:|.||....:.|.:..:....|           |:...|.|...|.|  
 Worm   127 VDLRIVIVGTILIISLFQFLSAKHKFSEAIEYATGVGK-----------FRNMAIKDGIDKGL-- 178

  Fly   186 LQPIGINFATVNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDHSFTPQKVVEFIRKKIPFNVF 250
                                            |.:|....|.::......:|:            
 Worm   179 --------------------------------LEMDRNGKLKKNKGVDNDEVI------------ 199

  Fly   251 KRIEHDNFNDFLGGWS-----DNRARALIFEPRSLTRLRYLLTAFEFYDRVA 297
            |:|..||. |..||:.     |..|...|..|  ||..||:.....:|.|.|
 Worm   200 KQIIIDNL-DVTGGYKRESIYDTLAWHTIIFP--LTIFRYIKWTALWYWRFA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 23/68 (34%)
DnaJ 30..91 CDD:278647 22/65 (34%)
TRX_DnaJ 134..244 CDD:239261 15/109 (14%)
dnj-2NP_502126.1 DnaJ 36..102 CDD:278647 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.