DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnj-24

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_498155.3 Gene:dnj-24 / 175745 WormBaseID:WBGene00001042 Length:249 Species:Caenorhabditis elegans


Alignment Length:242 Identity:59/242 - (24%)
Similarity:82/242 - (33%) Gaps:107/242 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAE----KFIQIKLAYEIL------AD 83
            :.||..|||:..:...||::||::||.||||||..:|...|    ||.:|..|||||      ||
 Worm     6 DSPYITLGISSTSDDVEIKKAYRKLALKWHPDKHTDDKSKEEAEQKFKKIAQAYEILTDKKKRAD 70

  Fly    84 LDR--------------------------------RRIF------------DRYGVSDINSQYFQ 104
            |||                                |..|            |.:...|::|..| 
 Worm    71 LDRTENPGLHRRRSTPGGMHRMHSHDMFRSPFDIFREFFGNRDPFENVFFDDAFTFPDVDSYAF- 134

  Fly   105 KKH-----DYSEYNRFTLNQNDDDFGQRFDIKQDIAFYQKLSITENYFEKMILS----------- 153
             ||     |::..|.:          .||...:...||.:...|:...:|...|           
 Worm   135 -KHPPRSADFTTKNHY----------HRFPSSRVHIFYDENKNTKERDDKNTFSTVIRFSSPTEP 188

  Fly   154 -KNA--------------KKV----------HVVMFYNDWCFKCTRI 175
             |||              ||:          |:|..:.|...||..:
 Worm   189 GKNATVRKTSTSTKLVDGKKIVTKTVENGDEHIVEVHEDGELKCRTV 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 35/117 (30%)
DnaJ 30..91 CDD:278647 34/114 (30%)
TRX_DnaJ 134..244 CDD:239261 15/78 (19%)
dnj-24NP_498155.3 DnaJ 9..>111 CDD:223560 33/101 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.