DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and Dnajc5

DIOPT Version :10

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_058055.1 Gene:Dnajc5 / 13002 MGIID:892995 Length:198 Species:Mus musculus


Alignment Length:64 Identity:29/64 - (45%)
Similarity:46/64 - (71%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YAILGINKKATTYEIREAYKELAKKWHPDK-VKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.:||::|.||:.:|:::|::||.|:|||| ..|...|:||.:|..|:.||.|..:|.|:|:||
Mouse    17 YHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYG 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:440252 27/62 (44%)
TRX_DnaJ 134..244 CDD:239261
Dnajc5NP_058055.1 PRK10767 17..>80 CDD:236757 27/62 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.