DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and DNAJC24

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_859057.4 Gene:DNAJC24 / 120526 HGNCID:26979 Length:149 Species:Homo sapiens


Alignment Length:168 Identity:35/168 - (20%)
Similarity:71/168 - (42%) Gaps:54/168 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGA-------EKFIQIKLAYEILADLDRR 87
            |.|:|||.:..|...::::.|::|...:||||...|..|       :|||:|..|::||.:.:.:
Human    11 DWYSILGADPSANISDLKQKYQKLILMYHPDKQSTDVPAGTVEECVQKFIEIDQAWKILGNEETK 75

  Fly    88 RIFDRY-------GVSDINSQYFQKKHDYSEYNRFTLNQNDDDF------GQRFDIKQDIAFYQK 139
            |.:|..       .|..:::|.:.::..:        |:.|..|      |.::.:.:|      
Human    76 REYDLQRCEDDLRNVGPVDAQVYLEEMSW--------NEGDHSFYLSCRCGGKYSVSKD------ 126

  Fly   140 LSITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVD 177
                           .|::|.::.     |..|:.|::
Human   127 ---------------EAEEVSLIS-----CDTCSLIIE 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 23/77 (30%)
DnaJ 30..91 CDD:278647 22/67 (33%)
TRX_DnaJ 134..244 CDD:239261 5/44 (11%)
DNAJC24NP_859057.4 DnaJ 11..79 CDD:365959 22/67 (33%)
zf-CSL 99..148 CDD:368338 10/80 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156721
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0715
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.