DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajb5

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:XP_012821923.1 Gene:dnajb5 / 100487123 XenbaseID:XB-GENE-995211 Length:407 Species:Xenopus tropicalis


Alignment Length:337 Identity:71/337 - (21%)
Similarity:128/337 - (37%) Gaps:103/337 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HVCSSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRR 87
            |......|.|.|||:...|...||::||:::|.|:||||.|:....:||.:|..||::|:|..:|
 Frog    56 HTLDMGKDYYKILGLASGANEDEIKKAYRKMALKYHPDKNKDANAEDKFKEIAEAYDVLSDPKKR 120

  Fly    88 RIFDRYGVSDIN-------------------------SQYFQKKHDYS--------------EYN 113
            .::|:||...:.                         :.:|...:.:.              ::.
 Frog   121 AVYDQYGEEGLKTGGGSTGNTGSSFHYTFHGDPHATFASFFGGSNPFDIFFGSSRSRMSNGFDHE 185

  Fly   114 RFTLNQNDDD----FGQRFDIKQDIAFYQKLSITENYFEKMILSK---------NAKKVHVVMFY 165
            ...:|:::||    || ||.......|:::       .:..:.|:         :..||.:...|
 Frog   186 DMDINEDEDDLFGGFG-RFGFSGVNGFHKR-------HQDQLHSRRKVQDPPVVHELKVSLEEIY 242

  Fly   166 NDWCFKCTRIVDAFKKILELLQPIGINFATVNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDH 230
            :.    ||:   ..|.....|.|.|....|.:.:  .:|..|.|.:|..::.        ..::.
 Frog   243 HG----CTK---RMKITRRRLNPDGRTVRTEDKI--LNVVIKKGWKEGTKIT--------FPKEG 290

  Fly   231 SFTPQKV---VEFIRKKIPFNVFKRIEHDNFN----------DFLGGWS------DNRARAL--- 273
            ..|.:.:   :.|:.|..|..:|||   |..|          :.|.|.:      |.|...|   
 Frog   291 DATSENIPADIVFLLKDKPHALFKR---DGSNIVYTAKITLKEALCGCTVNIPTIDGRVIPLPCS 352

  Fly   274 -IFEPRSLTRLR 284
             :.:|.::.|||
 Frog   353 DVIKPGAVKRLR 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 26/63 (41%)
DnaJ 30..91 CDD:278647 25/60 (42%)
TRX_DnaJ 134..244 CDD:239261 18/121 (15%)
dnajb5XP_012821923.1 DnaJ 60..402 CDD:223560 70/333 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.