DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)80Fg and dnajb4

DIOPT Version :9

Sequence 1:NP_001015187.2 Gene:l(3)80Fg / 3354941 FlyBaseID:FBgn0287183 Length:780 Species:Drosophila melanogaster
Sequence 2:NP_001096404.1 Gene:dnajb4 / 100125006 XenbaseID:XB-GENE-1007708 Length:357 Species:Xenopus tropicalis


Alignment Length:280 Identity:63/280 - (22%)
Similarity:107/280 - (38%) Gaps:93/280 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDYGAEKFIQIKLAYEILADLDRRRIFDRYG 94
            |.|::|||.|.|:..:|::||::.|.||||||.|:.:..|||.:|..|||:|:|..:|.::|::|
 Frog     4 DYYSVLGIEKGASEDDIKKAYRKQALKWHPDKNKSAHAEEKFKEIAEAYEVLSDPKKREVYDQFG 68

  Fly    95 VSDI------------NSQY-----------------------FQKK--------------HDYS 110
            ...:            |..|                       |.::              ..:|
 Frog    69 EEGLKGGSGAPDGHGGNFHYTFHGDPHATFAAFFGGANPFEIFFGRRMPGGRDDEDMELDGDPFS 133

  Fly   111 EYNRFTLN---QNDDDFGQRFDIKQD--IAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDWCF 170
            .:..|.:|   :..:..|.:|..|||  |....::|:.|.|                       .
 Frog   134 SFTSFNMNGFPREKNQVGNQFRRKQDPPIIHDLRVSLEEIY-----------------------T 175

  Fly   171 KCTRIVDAFKKILELLQPIGINFATVNAVHEESVFRKCGAREVPQLVLILDNQYFLYRDHSFTPQ 235
            .||:.:...:|   .|.|.|.:..|.:.:....:  |.|.:|..::.        ..|:....|.
 Frog   176 GCTKRMRISRK---RLNPDGRSVRTEDKILTIEI--KKGWKEGTKIT--------FPREGDEAPM 227

  Fly   236 KV---VEFIRKKIPFNVFKR 252
            .:   :.|:.|..|...|||
 Frog   228 TIPADIVFVVKDKPHTHFKR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)80FgNP_001015187.2 DnaJ 30..>94 CDD:223560 29/63 (46%)
DnaJ 30..91 CDD:278647 28/60 (47%)
TRX_DnaJ 134..244 CDD:239261 17/112 (15%)
dnajb4NP_001096404.1 DnaJ_bact 4..307 CDD:274090 63/280 (23%)
DnaJ 4..65 CDD:278647 28/60 (47%)
DnaJ_C 160..304 CDD:199909 22/124 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.