DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment l(3)80Fg and Dnajc3

DIOPT Version :9

Sequence 1:	NP_001015187.2	Gene:	l(3)80Fg / 3354941	FlyBaseID:	FBgn0287183	Length:	780	Species:	Drosophila melanogaster
Sequence 2:	NP_032955.2	Gene:	Dnajc3 / 100037258	MGIID:	107373	Length:	504	Species:	Mus musculus

Alignment Length:	70	Identity:	29/70 - (41%)
Similarity:	42/70 - (60%)	Gaps:	4/70 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 SSLNDPYAILGINKKATTYEIREAYKELAKKWHPDKVKND----YGAEKFIQIKLAYEILADLDR 86
            |...|.|.|||:.:.|...||.:||::||.:||||..:|:    ...:|||.|..|.|:|:|.:.
Mouse   390 SQKRDYYKILGVKRNAKKQEIIKAYRKLALQWHPDNFQNEEEKKKAEKKFIDIAAAKEVLSDPEM 454

  Fly    87 RRIFD 91
            |:.||
Mouse   455 RKKFD 459

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
l(3)80Fg	NP_001015187.2	DnaJ	30..>94	CDD:223560	28/66 (42%)
		DnaJ	30..91	CDD:278647	26/64 (41%)
		TRX_DnaJ	134..244	CDD:239261
Dnajc3	NP_032955.2	TPR_11	36..100	CDD:290150
		TPR 1	37..70
		TPR repeat	37..65	CDD:276809
		TPR repeat	70..100	CDD:276809
		TPR 2	72..104
		TPR_11	73..136	CDD:290150
		TPR 3	105..138
		TPR repeat	105..133	CDD:276809
		TPR_1	107..137	CDD:278916
		TPR_11	153..217	CDD:290150
		TPR 4	154..187
		TPR repeat	157..182	CDD:276809
		TPR_11	187..252	CDD:290150
		TPR repeat	187..217	CDD:276809
		TPR 5	188..221
		TPR 6	222..255
		TPR repeat	222..250	CDD:276809
		TPR repeat	256..280	CDD:276809
		TPR 7	268..301
		TPR repeat	301..335	CDD:276809
		TPR 8	306..339
		TPR_19	318..382	CDD:291240
		TPR 9	340..373
		TPR_1	340..373	CDD:278916
		TPR repeat	340..368	CDD:276809
		TPR repeat	374..397	CDD:276809	2/6 (33%)
		Flexible linker. /evidence=ECO:0000250	375..393		1/2 (50%)
		DnaJ	392..>498	CDD:223560	28/68 (41%)
		DnaJ	394..459	CDD:278647	26/64 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	451..481		4/9 (44%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167847120
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930