DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Maf1 and Maf1

DIOPT Version :9

Sequence 1:NP_001015167.2 Gene:Maf1 / 3354925 FlyBaseID:FBgn0267861 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001158079.1 Gene:Maf1 / 68877 MGIID:1916127 Length:258 Species:Mus musculus


Alignment Length:229 Identity:129/229 - (56%)
Similarity:169/229 - (73%) Gaps:7/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLESSRFEAINNALSIQTSGITIFGRIESYSCKMVAAEKVLYKRFTADSHGHDLQALSPPQTL 65
            |||||:|.|||||:.|:::|....|.||||||||||...:|.::|:|..:...|.|:||||||| 
Mouse     1 MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQT- 64

  Fly    66 ADFSPNFRRNNSQSGDEGITLCDTISRKTLFYLIATLNASFEPDYDFSEAKSHEFSKEPSLQWVM 130
            :..||: |.:.||.|::...|.|..|||||||||||||.||.||||||.|:|||||:||||:||:
Mouse    65 SGLSPS-RLSKSQGGEDESPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLRWVV 128

  Fly   131 NSIHANLSALAGDKYQAIRQPLWSAVDDEVILSECDIYSYNPDLSCDPFGEPGCLWSFNYFFYNK 195
            |:::.:|.:...:.::|::..||:|||:|:.|:|||||||||||..|||||.|.|||||||||||
Mouse   129 NAVNCSLFSAVREDFKALKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGEDGSLWSFNYFFYNK 193

  Fly   196 KLKRIVFFTSRAVN-SLY----AGETLPFSMEEE 224
            :|||||||:.|::: |.|    ||..|...:..|
Mouse   194 RLKRIVFFSCRSISGSTYTPSEAGNALDLELGAE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Maf1NP_001015167.2 Maf1 25..204 CDD:286283 108/178 (61%)
Maf1NP_001158079.1 Maf1 25..202 CDD:401206 106/176 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..85 13/26 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 226..253


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835676
Domainoid 1 1.000 228 1.000 Domainoid score I2489
eggNOG 1 0.900 - - E1_COG5046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49867
Inparanoid 1 1.050 257 1.000 Inparanoid score I3141
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55437
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003656
OrthoInspector 1 1.000 - - oto93064
orthoMCL 1 0.900 - - OOG6_102476
Panther 1 1.100 - - LDO PTHR22504
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2528
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.