DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Maf1 and mafr-1

DIOPT Version :9

Sequence 1:NP_001015167.2 Gene:Maf1 / 3354925 FlyBaseID:FBgn0267861 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_492777.1 Gene:mafr-1 / 172953 WormBaseID:WBGene00016622 Length:245 Species:Caenorhabditis elegans


Alignment Length:239 Identity:75/239 - (31%)
Similarity:109/239 - (45%) Gaps:47/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLESSRFEAINNALSIQTSGITIFGRIESYSCKMVAAEKVLYKR------------------- 46
            ||.||||..:..:..|........|..::|:||.|||.:||..:|.                   
 Worm     1 MKFLESSEMDVFSQTLVTGAIDCVIDFKLETYSSKMVTSEKKQWKSNDKSVIWGERQPLGSYEEM 65

  Fly    47 -FTAD---SHGHDLQALSPPQTLADFSPNFRRNNSQSGDEGITLCDTISRKTLFYLIATLNASFE 107
             .:|.   .|.|.|:.||..........:|..|:       ..:.|:||||.|:.|...||.|| 
 Worm    66 VMSASPSVGHNHRLRHLSERSCSGGSDNDFDVND-------YLIKDSISRKKLYDLTQVLNCSF- 122

  Fly   108 PDYDFSEAKSHEFSKEPSLQWVMNSIHANLSALAGDKYQAI-------RQPLWSAVDDEVILSEC 165
            ||:|||.|.|..|:       ::|  :::||.|...|.:.|       |:.||..:|:.::..:|
 Worm   123 PDHDFSNANSEAFA-------LVN--YSDLSRLVDMKLETIVRDYHVRREELWGIIDEAIVPGDC 178

  Fly   166 DIYSYNPDLSCDPFGEPGCLWSFNYFFYNKKLKRIVFFTSRAVN 209
            .|||:......|||.|.||:|:..:.||||.|||.|..|.|.::
 Worm   179 QIYSFKSQFEDDPFTEDGCIWALAFIFYNKGLKRFVLLTIRCLS 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Maf1NP_001015167.2 Maf1 25..204 CDD:286283 66/208 (32%)
mafr-1NP_492777.1 Maf1 25..217 CDD:286283 66/208 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166226
Domainoid 1 1.000 92 1.000 Domainoid score I4850
eggNOG 1 0.900 - - E1_COG5046
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H49867
Inparanoid 1 1.050 104 1.000 Inparanoid score I3535
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55437
OrthoDB 1 1.010 - - D406946at33208
OrthoFinder 1 1.000 - - FOG0003656
OrthoInspector 1 1.000 - - oto18371
orthoMCL 1 0.900 - - OOG6_102476
Panther 1 1.100 - - LDO PTHR22504
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1800
SonicParanoid 1 1.000 - - X2528
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.