DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dbp80 and CG5800

DIOPT Version :9

Sequence 1:NP_001263168.1 Gene:Dbp80 / 3354919 FlyBaseID:FBgn0024804 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_573230.1 Gene:CG5800 / 32742 FlyBaseID:FBgn0030855 Length:826 Species:Drosophila melanogaster


Alignment Length:451 Identity:114/451 - (25%)
Similarity:189/451 - (41%) Gaps:95/451 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDWAKKAEDQEVSKLVDKLNLDSKSGEETDFDVADPAETSLLIKILGKGLVNTKLSLDIQQKNPN 66
            ||.::|...||::|  .:|             .|..||..                 |::.|...
  Fly    33 GDNSQKRPRQEINK--SRL-------------AATEAEIQ-----------------DLKTKYAE 65

  Fly    67 SPLHSVKTFEALHLKASLLKGIYAMGFNTPSKIQETAL-PTLLADPPQNMIAQSQSGTGKTAAFV 130
            ....::|.|....|.....|.:....|..|:::|..:: |.|..   ::::..:.:|:|||.||:
  Fly    66 IDATAIKKFAQFPLSKKTQKALAESKFVHPTQVQRDSIGPALQG---KDVLGAAITGSGKTLAFL 127

  Fly   131 LAMLSRVNVCLNH------PQVLCLSPTYELAIQTGEVAARMGQFCREIKLRFAVRGEEV--DRS 187
            :.:|.  ::.:|.      ...:.:|||.|||.|..|...::|:. .:......:.|:.:  :|:
  Fly   128 IPVLE--HLFMNKWSRTDGVGAIIISPTRELAYQIFETLKKVGKH-HDFSAGLIIGGKNLKFERT 189

  Fly   188 KKIEEHILIGTPGKLLDWGIKFRLFDMKKISVFVLDEADVMIATQGHHDQCIRI--HKMLN---- 246
            :..:.:|||.|||:||....:..||:...:.:.|||||          |:|:.:  .|.||    
  Fly   190 RMDQCNILICTPGRLLQHMDENPLFNTSTMEMLVLDEA----------DRCLDMGFQKTLNSIIE 244

  Fly   247 ---PHCQMLFFSATYGKEVMDFARLIVADPTII----RLMREEESL--------------ENIKQ 290
               |..|.|.||||....|.|.|||.:.||..:    ...|||.|.              |.::|
  Fly   245 NFPPVRQTLLFSATQTNTVQDLARLNLKDPVYVGYGGATPREEPSASTKKTPNTAVLAVPELLQQ 309

  Fly   291 YYVKCKNEEGKYNAIQNIYGCISVGQAIIFCHTKRTAAWL---AAKMTSDGHSVAVLTGDLTVVQ 352
            .|| ..|.|.|...:.:........:.|:|..:.:.|.:|   ..|: ..|..:..|.|.|...:
  Fly   310 SYV-VLNLEDKITMLWSFIKNHLKQKIIVFVASCKQAKYLYEIFCKL-RPGSPLLALYGTLHQDR 372

  Fly   353 RLDVLDRFRSGLEKVLITTNILSRGIDIEQVTIVVNFDLPVDLDGMADCETYLHRIGRTGR 413
            |:.:.:.|......|:.:|::.|||:|...|..||..|.|.|:      ..|:||.||:.|
  Fly   373 RIAIYEDFLRKSHVVMFSTDVASRGLDFPAVNWVVQLDCPEDV------SQYIHRAGRSAR 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dbp80NP_001263168.1 DEADc 75..277 CDD:238167 61/223 (27%)
DEXDc 88..291 CDD:214692 63/238 (26%)
Helicase_C 299..414 CDD:278689 31/118 (26%)
CG5800NP_573230.1 PRK01297 2..471 CDD:234938 114/451 (25%)
DEADc 74..277 CDD:238167 61/218 (28%)
HELICc 311..437 CDD:238034 34/125 (27%)
DUF4217 474..530 CDD:290667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451428
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.