DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL15 and RPL15A

DIOPT Version :9

Sequence 1:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_013129.1 Gene:RPL15A / 850716 SGDID:S000004019 Length:204 Species:Saccharomyces cerevisiae


Alignment Length:204 Identity:137/204 - (67%)
Similarity:164/204 - (80%) Gaps:1/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
            ||||:|::||.|||||||:|:|.|:|||:|||...:||:.|||||||||||||:|||||||||:|
Yeast     1 MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRLGYKAKQGFVIYRVR 65

  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
            ||||.||||||||.|||||.:.|||:||..|.|::.||||||||...||||||||:.||::||||
Yeast    66 VRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYWVNQDSTYKYF 130

  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195
            ||||:|..|.|||||.:.||||..||||||.||||:.||.||||.||::::.|..| ||..|||:
Yeast   131 EVILVDPQHKAIRRDARYNWICDPVHKHREARGLTATGKKSRGINKGHKFNNTKAG-RRKTWKRQ 194

  Fly   196 NREHMHRKR 204
            |...:.|.|
Yeast   195 NTLSLWRYR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 130/188 (69%)
RPL15ANP_013129.1 Ribosomal_L15e 2..189 CDD:395665 129/187 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344715
Domainoid 1 1.000 280 1.000 Domainoid score I258
eggNOG 1 0.900 - - E1_COG1632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37713
Inparanoid 1 1.050 292 1.000 Inparanoid score I522
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62174
OrthoFinder 1 1.000 - - FOG0002642
OrthoInspector 1 1.000 - - otm46924
orthoMCL 1 0.900 - - OOG6_100733
Panther 1 1.100 - - LDO PTHR11847
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1745
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.