DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL15 and AT4G16720

DIOPT Version :9

Sequence 1:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_193405.1 Gene:AT4G16720 / 827375 AraportID:AT4G16720 Length:204 Species:Arabidopsis thaliana


Alignment Length:205 Identity:132/205 - (64%)
Similarity:163/205 - (79%) Gaps:2/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
            ||||:|:.||:|||||||||:|.|:|.|:|||...:.|..|||||||||||||:||||||:||:|
plant     1 MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQQPSIVRLVRPTRPDKARRLGYKAKQGFVVYRVR 65

  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
            |||||||||||||..||||.:.||.|||..|..:|:||||.||:||||||:||||:.:|::|||:
plant    66 VRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLRVVNSYWLNEDSTYKYY 130

  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGI-GKGYRYSQTIGGSRRAAWKR 194
            |:||:|..|:|:|.||:|||||..||||||||||||.||.:||: |||:...:. ..||||.||:
plant   131 EIILVDPAHNAVRNDPRINWICNPVHKHRELRGLTSEGKKNRGLRGKGHNNHKN-RPSRRATWKK 194

  Fly   195 KNREHMHRKR 204
            .|...:.|.|
plant   195 NNSLSLRRYR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 125/189 (66%)
AT4G16720NP_193405.1 PTZ00026 1..204 CDD:185402 131/203 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 267 1.000 Domainoid score I451
eggNOG 1 0.900 - - E1_COG1632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37713
Inparanoid 1 1.050 280 1.000 Inparanoid score I874
OMA 1 1.010 - - QHG62174
OrthoDB 1 1.010 - - D1181691at2759
OrthoFinder 1 1.000 - - FOG0002642
OrthoInspector 1 1.000 - - otm3121
orthoMCL 1 0.900 - - OOG6_100733
Panther 1 1.100 - - O PTHR11847
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.