DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL15 and zgc:153668

DIOPT Version :9

Sequence 1:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001070220.1 Gene:zgc:153668 / 767785 ZFINID:ZDB-GENE-060929-188 Length:204 Species:Danio rerio


Alignment Length:204 Identity:154/204 - (75%)
Similarity:182/204 - (89%) Gaps:0/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
            ||||:|||||||||||||||||||::.||||||.::.|:|||:||:||||||||||||:||||.|
Zfish     1 MGAYKYMQELYRKKQSDVMRYLLRLKCWQYRQLNRITRAPRPSRPEKARRLGYRAKQGYVIYRTR 65

  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
            ||||||||||||||||||||:||||.|||.|.||::||||||||.||||||||||:.|:|:||::
Zfish    66 VRRGGRKRPVPKGCTYGKPKTHGVNSLKPARNLQAVAEERVGRRCGGLRVLNSYWVGQNATYKFY 130

  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195
            ||||:|..|.||||:|:..||||.||||||||||||||:.|||:|||:.||:|||||::|.|||:
Zfish   131 EVILVDPMHKAIRRNPEAQWICKAVHKHRELRGLTSAGRRSRGLGKGHGYSRTIGGSKKACWKRR 195

  Fly   196 NREHMHRKR 204
            |...:.|||
Zfish   196 NTLSLRRKR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 145/188 (77%)
zgc:153668NP_001070220.1 Ribosomal_L15e 2..191 CDD:279200 145/188 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.