Sequence 1: | NP_001015155.1 | Gene: | RpL15 / 3354918 | FlyBaseID: | FBgn0028697 | Length: | 204 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001070220.1 | Gene: | zgc:153668 / 767785 | ZFINID: | ZDB-GENE-060929-188 | Length: | 204 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 154/204 - (75%) |
---|---|---|---|
Similarity: | 182/204 - (89%) | Gaps: | 0/204 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
Fly 66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
Fly 131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195
Fly 196 NREHMHRKR 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpL15 | NP_001015155.1 | Ribosomal_L15e | 2..191 | CDD:395665 | 145/188 (77%) |
zgc:153668 | NP_001070220.1 | Ribosomal_L15e | 2..191 | CDD:279200 | 145/188 (77%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |