DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL15 and rpl15

DIOPT Version :9

Sequence 1:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_001011478.1 Gene:rpl15 / 496969 XenbaseID:XB-GENE-960250 Length:204 Species:Xenopus tropicalis


Alignment Length:204 Identity:153/204 - (75%)
Similarity:176/204 - (86%) Gaps:0/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
            ||||:|||||:|||||||||:|||:|.||||||:.|||:||||||||||||||:||||:||||:|
 Frog     1 MGAYKYMQELWRKKQSDVMRFLLRVRCWQYRQLSSLHRAPRPTRPDKARRLGYKAKQGYVIYRVR 65

  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
            |||||||||||||.|||||..|||||||..|.|||:||||.||..||||||:.||:.:|::||:|
 Frog    66 VRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGGLRVLSFYWVGEDSTYKFF 130

  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195
            |||||||.|.||||:|...||.|.||||||:||||||||.|||:|||::|..||||||||.|||:
 Frog   131 EVILIDTFHKAIRRNPDTQWITKSVHKHREMRGLTSAGKKSRGLGKGHKYHITIGGSRRACWKRR 195

  Fly   196 NREHMHRKR 204
            |...:||.|
 Frog   196 NTLQLHRYR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 144/188 (77%)
rpl15NP_001011478.1 Ribosomal_L15e 2..191 CDD:307117 144/188 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 313 1.000 Domainoid score I1282
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37713
Inparanoid 1 1.050 332 1.000 Inparanoid score I2392
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1181691at2759
OrthoFinder 1 1.000 - - FOG0002642
OrthoInspector 1 1.000 - - oto104907
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1110
SonicParanoid 1 1.000 - - X1745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.