DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL15 and rpl15

DIOPT Version :9

Sequence 1:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_588438.1 Gene:rpl15 / 2539470 PomBaseID:SPCC576.11 Length:201 Species:Schizosaccharomyces pombe


Alignment Length:204 Identity:132/204 - (64%)
Similarity:157/204 - (76%) Gaps:3/204 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
            ||||:|::||.:||||||..:|.|:|.|:|||:..:||:.||:||||||||||:||||:||||||
pombe     1 MGAYKYLEELAKKKQSDVNLFLSRVRAWEYRQMNVIHRASRPSRPDKARRLGYKAKQGYVIYRIR 65

  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
            |||||||||||||.|||||...|||.||..|..:..|||||||....||||||||:.|||:||:|
pombe    66 VRRGGRKRPVPKGQTYGKPVHQGVNHLKYQRSARCTAEERVGRYCSNLRVLNSYWVNQDATYKFF 130

  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195
            ||||:|..|.||||||:||||...||||||.|||||.||.|||||||:|::.:   .:.|.|.|.
pombe   131 EVILVDPSHKAIRRDPRINWIVNPVHKHRESRGLTSIGKKSRGIGKGHRFNNS---PQHATWLRH 192

  Fly   196 NREHMHRKR 204
            |...:.|.|
pombe   193 NTLSLRRYR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 125/188 (66%)
rpl15NP_588438.1 Ribosomal_L15e 2..182 CDD:279200 125/179 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 269 1.000 Domainoid score I335
eggNOG 1 0.900 - - E1_COG1632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37713
Inparanoid 1 1.050 276 1.000 Inparanoid score I688
OMA 1 1.010 - - QHG62174
OrthoFinder 1 1.000 - - FOG0002642
OrthoInspector 1 1.000 - - otm47370
orthoMCL 1 0.900 - - OOG6_100733
Panther 1 1.100 - - O PTHR11847
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1110
SonicParanoid 1 1.000 - - X1745
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.