DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL15 and Rpl15

DIOPT Version :9

Sequence 1:NP_001015155.1 Gene:RpL15 / 3354918 FlyBaseID:FBgn0028697 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_620814.1 Gene:Rpl15 / 245981 RGDID:621181 Length:204 Species:Rattus norvegicus


Alignment Length:204 Identity:151/204 - (74%)
Similarity:176/204 - (86%) Gaps:0/204 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGAYRYMQELYRKKQSDVMRYLLRIRVWQYRQLTKLHRSPRPTRPDKARRLGYRAKQGFVIYRIR 65
            ||||:|:|||:|||||||||:|||:|.||||||:.|||:||||||||||||||:||||:||||||
  Rat     1 MGAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRLGYKAKQGYVIYRIR 65

  Fly    66 VRRGGRKRPVPKGCTYGKPKSHGVNQLKPYRGLQSIAEERVGRRLGGLRVLNSYWIAQDASYKYF 130
            |||||||||||||.|||||..|||||||..|.|||:||||.||..|.||||||||:.:|::||:|
  Rat    66 VRRGGRKRPVPKGATYGKPVHHGVNQLKFARSLQSVAEERAGRHCGALRVLNSYWVGEDSTYKFF 130

  Fly   131 EVILIDTHHSAIRRDPKINWICKHVHKHRELRGLTSAGKSSRGIGKGYRYSQTIGGSRRAAWKRK 195
            ||||||..|.||||:|...||.|.||||||:|||||||:.|||:|||:::..||||||||||:|:
  Rat   131 EVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKSRGLGKGHKFHHTIGGSRRAAWRRR 195

  Fly   196 NREHMHRKR 204
            |...:||.|
  Rat   196 NTLQLHRYR 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL15NP_001015155.1 Ribosomal_L15e 2..191 CDD:395665 142/188 (76%)
Rpl15NP_620814.1 Ribosomal_L15e 2..191 CDD:395665 142/188 (76%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..186 12/20 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345454
Domainoid 1 1.000 308 1.000 Domainoid score I1295
eggNOG 1 0.900 - - E1_COG1632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37713
Inparanoid 1 1.050 327 1.000 Inparanoid score I2385
OMA 1 1.010 - - QHG62174
OrthoDB 1 1.010 - - D1181691at2759
OrthoFinder 1 1.000 - - FOG0002642
OrthoInspector 1 1.000 - - otm46092
orthoMCL 1 0.900 - - OOG6_100733
Panther 1 1.100 - - LDO PTHR11847
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1745
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.