DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and CDK1

DIOPT Version :10

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001777.1 Gene:CDK1 / 983 HGNCID:1722 Length:297 Species:Homo sapiens


Alignment Length:54 Identity:16/54 - (29%)
Similarity:27/54 - (50%) Gaps:2/54 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 QSPPVSPIDMESQERIKLERKRLRNRVAASKC-RKRKLERISKLEDRVKELKAQ 309
            :.|...|.:..|:|.| .||.||:.:..|.:. |:::.|...|..|.:...||:
Human    84 EGPGDKPYEEISEELI-AERARLQAQKEAEELWRQKEAEITKKFRDALANEKAR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 16/54 (30%)
CDK1NP_001777.1 STKc_CDK1_euk 3..287 CDD:270845 16/54 (30%)

Return to query results.
Submit another query.