DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and SMK1

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_015379.1 Gene:SMK1 / 856167 SGDID:S000006258 Length:388 Species:Saccharomyces cerevisiae


Alignment Length:376 Identity:146/376 - (38%)
Similarity:218/376 - (57%) Gaps:25/376 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSA--DDTLTNQRVAIKKISP-F 72
            :|...:...||......:.:| .:...|..:.::|:||||.|.|.  .......|:|:||||. |
Yeast    12 INVASNLGAPQQRTIFAKERI-SIPGYYEIIQFLGKGAYGTVCSVKFKGRSPAARIAVKKISNIF 75

  Fly    73 EHQTYCQRTLREITILTRFK-HENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKTQ-RLS 135
            ..:...:|.:||:..:..|| |:||:::.| |.:.:......:|..|.|::.||.|::.:. :||
Yeast    76 NKEILLKRAIRELKFMNFFKGHKNIVNLID-LEIVTSSPYDGLYCYQELIDYDLAKVIHSSVQLS 139

  Fly   136 NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGF---- 196
            ..||.|||||||.||||||||:|:||||||.|:|......||||||||||     ..|.||    
Yeast   140 EFHIKYFLYQILCGLKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLAR-----GIHAGFFKCH 199

  Fly   197 ------LTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG 255
                  :|.|||||||||||::|:::.|:||:|||:|||||||..:.:|:|.|:..:.|:..|:.
Yeast   200 STVQPHITNYVATRWYRAPELLLSNQPYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIFEIIK 264

  Fly   256 VLGSPSRDDLECIINEKARNYLESL--PFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVE 318
            |||:|.:|.|......||.|..::.  |....:||:.:||.|...|::|:..:|.::...|:.||
Yeast   265 VLGTPDKDILIKFGTIKAWNLGKNSNNPVYKKIPWSNIFPFASHEAINLIESLLHWDSTHRLNVE 329

  Fly   319 EALAHPYLEQYYDPGDEPVA-EVPFRINMENDDISRDALKSLIFEETLKFK 368
            :|::||:|.:...|.||||. :.||....|::..|...|:..:.||...||
Yeast   330 QAISHPFLNEVRKPDDEPVCLQGPFDFTYESELNSMSKLRDYLVEEVKNFK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 140/351 (40%)
S_TKc 38..326 CDD:214567 127/304 (42%)
SMK1NP_015379.1 PKc_like 37..376 CDD:419665 139/344 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.