DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MPK11

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001117210.1 Gene:MPK11 / 839523 AraportID:AT1G01560 Length:369 Species:Arabidopsis thaliana


Alignment Length:344 Identity:170/344 - (49%)
Similarity:231/344 - (67%) Gaps:7/344 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IRGQIFEVGPRYI-KLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILT 89
            :.|.:|||..:|: .|..||.||.|:|.:|.::.|.:.|||||| :.|.:....:||||||.:|.
plant    28 VYGNLFEVSKKYVPPLRPIGRGASGIVCAAWNSETGEEVAIKKIGNAFGNIIDAKRTLREIKLLK 92

  Fly    90 RFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKT-QRLSNDHICYFLYQILRGLKYI 153
            ...|:|:|.|.||:|....|...||:||..||:|||:.:::: |.|::||..:||||:||||||:
plant    93 HMDHDNVIAIIDIIRPPQPDNFNDVHIVYELMDTDLHHIIRSNQPLTDDHSRFFLYQLLRGLKYV 157

  Fly   154 HSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGY 218
            ||||||||||||||||||..|||||.||||||    ....|.|:||||.||||||||::||...|
plant   158 HSANVLHRDLKPSNLLLNANCDLKIGDFGLAR----TKSETDFMTEYVVTRWYRAPELLLNCSEY 218

  Fly   219 TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFK 283
            |.:||||||||||.|:::..|:|||:.|:.||..|..::|||....|..:.::.||.|:..||..
plant   219 TAAIDIWSVGCILGEIMTREPLFPGRDYVQQLRLITELIGSPDDSSLGFLRSDNARRYVRQLPQY 283

  Fly   284 PNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMEN 348
            |...:|..|||....|:|||.|||.|:|::||.|:|||.||||...::..:|||...||..:.|.
plant   284 PRQNFAARFPNMSVNAVDLLQKMLVFDPNRRITVDEALCHPYLAPLHEYNEEPVCVRPFHFDFEQ 348

  Fly   349 DDISRDALKSLIFEETLKF 367
            ..::.:.:|.||:.|::||
plant   349 PSLTEENIKELIYRESVKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 167/336 (50%)
S_TKc 38..326 CDD:214567 152/290 (52%)
MPK11NP_001117210.1 STKc_TEY_MAPK 33..369 CDD:143363 169/339 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.