DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MPK10

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_191538.1 Gene:MPK10 / 825148 AraportID:AT3G59790 Length:393 Species:Arabidopsis thaliana


Alignment Length:342 Identity:179/342 - (52%)
Similarity:236/342 - (69%) Gaps:8/342 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GQIFEVGPRY-IKLAYIGEGAYGMVVSADDTLTNQRVAIKKISP-FEHQTYCQRTLREITILTRF 91
            |.|||:..:| ..:..||.||.|:|.||.|:.||::||||||:. |::....:||||||.:|..|
plant    50 GHIFELPAKYKPPIRPIGRGACGIVCSAVDSETNEKVAIKKITQVFDNTIEAKRTLREIKLLRHF 114

  Fly    92 KHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKT-QRLSNDHICYFLYQILRGLKYIHS 155
            .||||:.|||::.....|...|||||..|||.|||:.||: |.|:.||..||:||||||||||||
plant   115 DHENIVAIRDVILPPQRDSFEDVYIVNELMEFDLYRTLKSDQELTKDHGMYFMYQILRGLKYIHS 179

  Fly   156 ANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTK 220
            |||||||||||||||:..|||||||||||| |.||   :..:||||.||||||||::|.|..||.
plant   180 ANVLHRDLKPSNLLLSTQCDLKICDFGLAR-ATPE---SNLMTEYVVTRWYRAPELLLGSSDYTA 240

  Fly   221 SIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPN 285
            :||:||||||..|:::..|:||||..::||..:|.::|:||.::|.. ::|.|:.|:..||..|.
plant   241 AIDVWSVGCIFMEIMNREPLFPGKDQVNQLRLLLELIGTPSEEELGS-LSEYAKRYIRQLPTLPR 304

  Fly   286 VPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDD 350
            ..:.:.|||...||:||:.|||||:|.:||.|:||||||||..::|..|||....||..:::...
plant   305 QSFTEKFPNVPPLAIDLVEKMLTFDPKQRISVKEALAHPYLSSFHDITDEPECSEPFNFDLDEHP 369

  Fly   351 ISRDALKSLIFEETLKF 367
            .|.:..:.||:.|.|.|
plant   370 FSEEQFRELIYCEALAF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 175/336 (52%)
S_TKc 38..326 CDD:214567 161/290 (56%)
MPK10NP_191538.1 PKc_like 53..388 CDD:304357 177/339 (52%)
S_TKc 63..345 CDD:214567 160/286 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.