DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MPK3

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_190150.1 Gene:MPK3 / 823706 AraportID:AT3G45640 Length:370 Species:Arabidopsis thaliana


Alignment Length:342 Identity:172/342 - (50%)
Similarity:238/342 - (69%) Gaps:7/342 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IRGQIFEVGPRY-IKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILT 89
            |.|.:||:..:| ..:..||.||||:|.|..||.||:.||:||| :.|::....:||||||.:|.
plant    26 IFGSLFEITSKYRPPIIPIGRGAYGIVCSVLDTETNELVAMKKIANAFDNHMDAKRTLREIKLLR 90

  Fly    90 RFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLKT-QRLSNDHICYFLYQILRGLKYI 153
            ...|||||.|||::......|..||||...||:|||:::::: |.||.:|..|||||:|||||||
plant    91 HLDHENIIAIRDVVPPPLRRQFSDVYISTELMDTDLHQIIRSNQSLSEEHCQYFLYQLLRGLKYI 155

  Fly   154 HSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGY 218
            ||||::||||||||||||..|||||||||||| ...|:|   |:||||.||||||||::|||..|
plant   156 HSANIIHRDLKPSNLLLNANCDLKICDFGLAR-PTSEND---FMTEYVVTRWYRAPELLLNSSDY 216

  Fly   219 TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFK 283
            |.:||:||||||..|:::.:|:||||.::.|:..:..:||:|:..||....||.|:.|:..||..
plant   217 TAAIDVWSVGCIFMELMNRKPLFPGKDHVHQMRLLTELLGTPTESDLGFTHNEDAKRYIRQLPNF 281

  Fly   284 PNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMEN 348
            |..|.||||.:.:.:|:||:.:||||:|::||.||:||.|.||.:.:||.|||:.:.||....|.
plant   282 PRQPLAKLFSHVNPMAIDLVDRMLTFDPNRRITVEQALNHQYLAKLHDPNDEPICQKPFSFEFEQ 346

  Fly   349 DDISRDALKSLIFEETL 365
            ..:..:.:|.:|::|.:
plant   347 QPLDEEQIKEMIYQEAI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 170/337 (50%)
S_TKc 38..326 CDD:214567 155/290 (53%)
MPK3NP_190150.1 STKc_TEY_MAPK 31..367 CDD:143363 170/337 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.730

Return to query results.
Submit another query.