DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MPK19

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_188090.2 Gene:MPK19 / 820700 AraportID:AT3G14720 Length:598 Species:Arabidopsis thaliana


Alignment Length:341 Identity:155/341 - (45%)
Similarity:229/341 - (67%) Gaps:15/341 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISP-FEHQTYCQRTLREITILTRFKHENIIDIR 100
            ||..|..||:|:||:|.:|.||.|.::||||||:. |||.:...|.|||:.:|...:|.:|::|:
plant    24 RYRILEVIGKGSYGVVCAAIDTQTGEKVAIKKINDVFEHVSDALRILREVKLLRLLRHPDIVEIK 88

  Fly   101 DILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILRGLKYIHSANVLHRDLK 164
            .|:...|..:.:|:|:|..|||:||::::| ...|:.:|..:||||:||.|||:|:|||.|||||
plant    89 SIMLPPSKREFKDIYVVFELMESDLHQVIKANDDLTREHHQFFLYQMLRALKYMHTANVYHRDLK 153

  Fly   165 PSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEI--MLNSKGYTKSIDIWSV 227
            |.|:|.|..|.||:|||||||::..:...|.|.|:|||||||||||:  ...|| ||.:|||||:
plant   154 PKNILANANCKLKVCDFGLARVSFNDTPTTVFWTDYVATRWYRAPELCGSFCSK-YTPAIDIWSI 217

  Fly   228 GCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLF 292
            |||.||:|:.:|:||||..:.||:.|..:||:|..:.:..:.|||||.||..:..|..||:::.|
plant   218 GCIFAEVLTGKPLFPGKSVVHQLDLITDLLGTPKSETIAGVRNEKARKYLNEMRKKNLVPFSQKF 282

  Fly   293 PNADALALDLLGKMLTFNPHKRIPVEEALAHPY------LEQYYDPGDEPVAEVPFRINMENDDI 351
            ||||.|||.||.::|.|:|..|....||||.||      :|:  :|..:|::::.|  ..|...:
plant   283 PNADPLALRLLQRLLAFDPKDRPTAAEALADPYFKCLAKVER--EPSCQPISKMEF--EFERRRL 343

  Fly   352 SRDALKSLIFEETLKF 367
            ::|.::.||:.|.|::
plant   344 TKDDIRELIYREILEY 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 154/338 (46%)
S_TKc 38..326 CDD:214567 144/297 (48%)
MPK19NP_188090.2 STKc_TDY_MAPK 24..361 CDD:143364 155/341 (45%)
S_TKc 25..316 CDD:214567 143/291 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.