DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MPK7

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_179409.1 Gene:MPK7 / 816330 AraportID:AT2G18170 Length:368 Species:Arabidopsis thaliana


Alignment Length:348 Identity:166/348 - (47%)
Similarity:239/348 - (68%) Gaps:7/348 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKI-SPFEHQTYCQRTLREITILTRFKHE 94
            :||:..:|:.:..||.||||:|.|:.:..||:||||||| :.||::....|||||:.:|...:||
plant    25 LFEIDTKYVPIKPIGRGAYGVVCSSINRETNERVAIKKIHNVFENRVDALRTLRELKLLRHVRHE 89

  Fly    95 NIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLYQILRGLKYIHSANV 158
            |:|.::|::...:....:|||:|..||:|||::::| :|.||:||..|||:|:||||||:||||:
plant    90 NVIALKDVMLPANRSSFKDVYLVYELMDTDLHQIIKSSQSLSDDHCKYFLFQLLRGLKYLHSANI 154

  Fly   159 LHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID 223
            |||||||.|||:|..||||||||||||.:.....   |:||||.||||||||::|....|..|||
plant   155 LHRDLKPGNLLVNANCDLKICDFGLARTSQGNEQ---FMTEYVVTRWYRAPELLLCCDNYGTSID 216

  Fly   224 IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPW 288
            :||||||.||:|..:|||||...|:||..|:.|:||....|:..|.|.|||.:::|||:......
plant   217 VWSVGCIFAEILGRKPIFPGTECLNQLKLIINVVGSQQESDIRFIDNPKARRFIKSLPYSRGTHL 281

  Fly   289 AKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISR 353
            :.|:|.|:.||:|||.:||.|:|.|||.|.:||.|||:...:|||..|.|.||..:::: :::..
plant   282 SNLYPQANPLAIDLLQRMLVFDPTKRISVTDALLHPYMAGLFDPGSNPPAHVPISLDID-ENMEE 345

  Fly   354 DALKSLIFEETLKF-KERQPDNA 375
            ..::.:::.|.|.: .|.:..||
plant   346 PVIREMMWNEMLYYHPEAEISNA 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 162/335 (48%)
S_TKc 38..326 CDD:214567 151/289 (52%)
MPK7NP_179409.1 STKc_TEY_MAPK 26..361 CDD:143363 163/338 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 317 1.000 Domainoid score I288
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.