DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MAPK13

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_002745.1 Gene:MAPK13 / 5603 HGNCID:6875 Length:365 Species:Homo sapiens


Alignment Length:338 Identity:148/338 - (43%)
Similarity:220/338 - (65%) Gaps:9/338 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKIS-PFEHQTYCQRTLREITILTRFKHEN 95
            :|:...|:...::|.||||.|.||.|..:.::|||||:| ||:.:.:.:|..||:.:|...:|||
Human    19 WELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHEN 83

  Fly    96 IIDIRDILR-VDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVL 159
            :|.:.|:.. ..|:....|.|:|...|:|||.|::..: .|.:.|.|.:||:|:||||||||.|:
Human    84 VIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGME-FSEEKIQYLVYQMLKGLKYIHSAGVV 147

  Fly   160 HRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI 224
            ||||||.||.:|:.|:|||.||||||.||.|      :|.||.||||||||::|:...|.:::||
Human   148 HRDLKPGNLAVNEDCELKILDFGLARHADAE------MTGYVVTRWYRAPEVILSWMHYNQTVDI 206

  Fly   225 WSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWA 289
            ||||||:||||:.:.:|.||.|||||..||.|.|.|..:.::.:.::.|::|::|||..|...:.
Human   207 WSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFT 271

  Fly   290 KLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRD 354
            :|||.|...|.|||.|||..:..||:...:||.||:.|.:.||.:|..|:.||..::|::.::.|
Human   272 QLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD 336

  Fly   355 ALKSLIFEETLKF 367
            ..|..|::|.:.|
Human   337 EWKQHIYKEIVNF 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 147/335 (44%)
S_TKc 38..326 CDD:214567 134/289 (46%)
MAPK13NP_002745.1 STKc_p38delta 9..351 CDD:143384 148/338 (44%)
TXY 180..182 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.