DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MAPK8

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001265476.1 Gene:MAPK8 / 5599 HGNCID:6881 Length:427 Species:Homo sapiens


Alignment Length:376 Identity:144/376 - (38%)
Similarity:227/376 - (60%) Gaps:34/376 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKIS-PFEHQ 75
            |...|.|:..|...|::        ||..|..||.||.|:|.:|.|.:..:.|||||:| ||::|
Human     8 NNFYSVEIGDSTFTVLK--------RYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRPFQNQ 64

  Fly    76 TYCQRTLREITILTRFKHENIIDIRDILRVD-SIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHI 139
            |:.:|..||:.::....|:|||.:.::.... |:::.:|||||..||:.:|.::::.: |.::.:
Human    65 THAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQME-LDHERM 128

  Fly   140 CYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGF-LTEYVAT 203
            .|.|||:|.|:|::|||.::||||||||:::...|.|||.||||||.|.     |.| :|.||.|
Human   129 SYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAG-----TSFMMTPYVVT 188

  Fly   204 RWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECI 268
            |:|||||::| ..||.:::||||||||:.||:....:|||..::||.|.::..||:|..:.:: .
Human   189 RYYRAPEVIL-GMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPCPEFMK-K 251

  Fly   269 INEKARNYLESLPFKPNVPWAKLFPN----AD--------ALALDLLGKMLTFNPHKRIPVEEAL 321
            :....|.|:|:.|......:.||||:    ||        :.|.|||.|||..:..|||.|:|||
Human   252 LQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEAL 316

  Fly   322 AHPYLEQYYDP--GDEPVAEVPFRINMENDDISRDALKSLIFEETLKFKER 370
            .|||:..:|||  .:.|..::|.: .::..:.:.:..|.||::|.:..:||
Human   317 QHPYINVWYDPSEAEAPPPKIPDK-QLDEREHTIEEWKELIYKEVMDLEER 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 137/350 (39%)
S_TKc 38..326 CDD:214567 126/302 (42%)
MAPK8NP_001265476.1 STKc_JNK 25..360 CDD:270840 136/343 (40%)
TXY 183..185 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 371..427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.