DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and MAPK3

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_002737.2 Gene:MAPK3 / 5595 HGNCID:6877 Length:379 Species:Homo sapiens


Alignment Length:372 Identity:284/372 - (76%)
Similarity:314/372 - (84%) Gaps:11/372 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SGSVVNGTGSTE----------VPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTN 61
            :.:...|.|..|          || ...|:::||.|:|||||.:|.||||||||||.||.|.:..
Human     2 AAAAAQGGGGGEPRRTEGVGPGVP-GEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRK 65

  Fly    62 QRVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLY 126
            .|||||||||||||||||||||||.||.||:|||:|.||||||..:::.||||||||.|||||||
Human    66 TRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLY 130

  Fly   127 KLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEH 191
            ||||:|:||||||||||||||||||||||||||||||||||||:|.|||||||||||||||||||
Human   131 KLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEH 195

  Fly   192 DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGV 256
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||:
Human   196 DHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGI 260

  Fly   257 LGSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEAL 321
            |||||::||.||||.||||||:|||.|..|.||||||.:|:.|||||.:||||||:|||.|||||
Human   261 LGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEAL 325

  Fly   322 AHPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFK 368
            |||||||||||.||||||.||...||.||:.::.||.|||:||.:|:
Human   326 AHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 275/333 (83%)
S_TKc 38..326 CDD:214567 243/287 (85%)
MAPK3NP_002737.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 5/24 (21%)
STKc_ERK1_2_like 36..370 CDD:270839 275/333 (83%)
TXY 202..204 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 507 1.000 Domainoid score I328
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 591 1.000 Inparanoid score I988
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm41796
orthoMCL 1 0.900 - - OOG6_100339
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.