DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and Mapk4

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_062192.1 Gene:Mapk4 / 54268 RGDID:3047 Length:583 Species:Rattus norvegicus


Alignment Length:334 Identity:141/334 - (42%)
Similarity:204/334 - (61%) Gaps:24/334 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENI 96
            :::|.|:.....:|.|..|:|:||.|:...::||:|||...:.:: .:..||||.|:.|..|:||
  Rat    14 YDLGGRFTDFQPLGFGVNGLVLSATDSRACRKVAVKKIVLSDARS-MKHALREIKIIRRLDHDNI 77

  Fly    97 IDIRDILRVDSIDQMRDV------YIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHS 155
            :.:.::|.....|...::      ||||..|||||..||:...|:.:|...|:||:|||||||||
  Rat    78 VKVYEVLGPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGTLTEEHAKLFMYQLLRGLKYIHS 142

  Fly   156 ANVLHRDLKPSNLLLNKTCD--LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGY 218
            ||||||||||:|:.:: |.|  |||.|||||||||..:.|.|:|:|.:.|:|||:|.::|:...|
  Rat   143 ANVLHRDLKPANIFIS-TEDLVLKIGDFGLARIADQHYSHKGYLSEGLVTKWYRSPRLLLSPNNY 206

  Fly   219 TKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLP-- 281
            ||:||:|:.||||||||:.:.:|.|.|.|:|:..||        |.:..:..|.....|..:|  
  Rat   207 TKAIDMWAAGCILAEMLTGKMLFAGAHELEQMQLIL--------DTIPVVREEDKEELLRVMPSF 263

  Fly   282 ----FKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPF 342
                ::...|..||.|:.:..|:|.|.|:|||||..|:..|..|.|||:..|..|.|||.::.||
  Rat   264 VSSTWEVKRPLRKLLPDVNREAIDFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPF 328

  Fly   343 RINMENDDI 351
            ||..|.||:
  Rat   329 RIEDEIDDL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 141/334 (42%)
S_TKc 38..326 CDD:214567 126/301 (42%)
Mapk4NP_062192.1 STKc_MAPK4_6 14..351 CDD:143359 141/334 (42%)
Pkinase 20..312 CDD:278497 126/301 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.