DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and mapk4

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_998638.1 Gene:mapk4 / 406782 ZFINID:ZDB-GENE-040426-2835 Length:674 Species:Danio rerio


Alignment Length:346 Identity:146/346 - (42%)
Similarity:201/346 - (58%) Gaps:29/346 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISPFEHQTYCQRTLREITILTRFKHENI 96
            |::|.:|..|..:|.||.|:|:||.|..:..|||:||: ........:..|||:.|..|.:|||:
Zfish    13 FDLGAQYQDLRPLGTGASGLVLSALDRRSGLRVAVKKL-VMRDAVSVKHALREVKITRRLQHENV 76

  Fly    97 IDIRDILRVDSIDQMRD------VYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHS 155
            :.:.|:|........||      :||||..|||||.:||:...|..:|.....||:|||||:|||
Zfish    77 VRVYDVLGSSGHPLPRDLTHVAAIYIVQECMETDLARLLEQGPLPAEHATLLFYQLLRGLKFIHS 141

  Fly   156 ANVLHRDLKPSNLLLN-KTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYT 219
            ||||||||||:|:.:| :...|||.|||||||.||.:.|.|:|:|.:.|:|||:|.::|:...||
Zfish   142 ANVLHRDLKPANIFINTEQMLLKIGDFGLARIVDPHYSHKGYLSEGMVTKWYRSPRLLLSPNNYT 206

  Fly   220 KSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKP 284
            |:||:|:.||||||||:.|.:|.|.|.|:|:..||        |.:..|..|..:..|..:|...
Zfish   207 KAIDMWAAGCILAEMLTGRMLFAGAHELEQMQLIL--------DTVPVIREEDRQELLRVMPSLV 263

  Fly   285 NVPW------AKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFR 343
            ...|      ..|.|..:..|:|.|..:|||||..|:..|.||..|:|::|..|.||||:..|||
Zfish   264 GHGWQIRRSFRDLMPEVEDKAIDFLESILTFNPMDRLTAEAALCQPFLQRYSCPQDEPVSLQPFR 328

  Fly   344 INMENDDISRDALKSLIFEET 364
            |..|.:|       ||:.|.|
Zfish   329 IEDELED-------SLVTEST 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 146/346 (42%)
S_TKc 38..326 CDD:214567 127/300 (42%)
mapk4NP_998638.1 STKc_MAPK4_6 13..352 CDD:143359 146/346 (42%)
S_TKc 19..311 CDD:214567 127/300 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.