DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and mapk3

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_958915.1 Gene:mapk3 / 399480 ZFINID:ZDB-GENE-040121-1 Length:392 Species:Danio rerio


Alignment Length:371 Identity:291/371 - (78%)
Similarity:308/371 - (83%) Gaps:9/371 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SGSVVNGTGSTEVP---------QSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQ 62
            |.|...|.|....|         :...|.::||.|:|||||..|.||||||||||.||.|.:...
Zfish    16 SNSSAAGPGGAVAPGGPSGAAGSKPGLESVKGQNFDVGPRYTDLQYIGEGAYGMVCSAFDNVNKI 80

  Fly    63 RVAIKKISPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYK 127
            |||||||||||||||||||||||.||.||.|||||.|.||||...||.||||||||.||||||||
Zfish    81 RVAIKKISPFEHQTYCQRTLREIKILLRFHHENIIGINDILRARHIDYMRDVYIVQDLMETDLYK 145

  Fly   128 LLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHD 192
            |||||:||||||||||||||||||||||||||||||||||||:|.||||||||||||||||||||
Zfish   146 LLKTQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHD 210

  Fly   193 HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVL 257
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Zfish   211 HTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVL 275

  Fly   258 GSPSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALA 322
            ||||:|||.||||.||||||:|||.||.:||.||||.||..|||||.:||||||.|||.||:|||
Zfish   276 GSPSQDDLNCIINMKARNYLQSLPQKPKIPWNKLFPKADNKALDLLDRMLTFNPLKRINVEQALA 340

  Fly   323 HPYLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKFK 368
            ||||||||||.||||||.||..|||.||:.::.||.||||||.:|:
Zfish   341 HPYLEQYYDPSDEPVAEEPFTFNMELDDLPKEKLKELIFEETARFQ 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 282/333 (85%)
S_TKc 38..326 CDD:214567 248/287 (86%)
mapk3NP_958915.1 STKc_ERK1_2_like 50..384 CDD:270839 282/333 (85%)
S_TKc 56..344 CDD:214567 248/287 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 508 1.000 Domainoid score I318
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 595 1.000 Inparanoid score I935
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm26463
orthoMCL 1 0.900 - - OOG6_100339
Panther 1 1.100 - - O PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X259
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.