DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and nmo

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster


Alignment Length:405 Identity:153/405 - (37%)
Similarity:227/405 - (56%) Gaps:57/405 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SGSVVNGTGSTEVPQSNAEVIRGQIFEVGPRYIKLAY---------IGEGAYGMVVSADDTLTNQ 62
            |.|:|.|..:...||..:.::..    ..|.|...|.         ||.||:|:|.:..|....:
  Fly     4 SMSLVQGGAAGGAPQGASAILAA----AAPYYQPPAVPQDVQPDRPIGYGAFGVVWAVTDPRDGR 64

  Fly    63 RVAIKKI-SPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLY 126
            |||:||: :.|:.....:|..||:.:|..|||||::...|||:...:|..:::|::..|:::||:
  Fly    65 RVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPHLDFFQEIYVITELLQSDLH 129

  Fly   127 KLL-KTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPE 190
            |:: ..|.||.|||..|||||||||||:|||.:||||:||.|||:|..|.||||||||||:.:| 
  Fly   130 KIIVSPQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLVNSNCVLKICDFGLARVEEP- 193

  Fly   191 HDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG 255
             |....:|:.|.|::||||||::.::.|:.::|:||||||..|:|..|.:|..::.:.||..|..
  Fly   194 -DQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGRRILFQAQNPVQQLELITE 257

  Fly   256 VLGSPSRDDLE--CIINEKARNY-LESLPFKPNVPWAKLF---PNADALALDLLGKMLTFNPHKR 314
            :||:|:.:|:.  |   |.||.: |...|..|:  ::.|:   .:|...|:.||.:||.|:|.||
  Fly   258 LLGTPTMEDMRHAC---EGARTHMLRRAPKPPS--FSVLYTLSSHATHEAVHLLCQMLVFDPDKR 317

  Fly   315 IPVEEALAHPYLEQ---------------------YYDPGDEPVAEVPFRINMENDDISRDALKS 358
            |.|.:|||||||::                     .|....||.|..||      ||:....|.|
  Fly   318 ISVTDALAHPYLDEGRLRYHSCMCKCCFTTSAGMRQYTADFEPSAGQPF------DDLWERKLTS 376

  Fly   359 L--IFEETLKFKERQ 371
            :  :.||..||...|
  Fly   377 VQQVKEEMHKFIAEQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 144/373 (39%)
S_TKc 38..326 CDD:214567 129/304 (42%)
nmoNP_001356976.1 STKc_NLK 39..411 CDD:173748 144/366 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D309855at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.