DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and CG8565

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:NP_573080.1 Gene:CG8565 / 32538 FlyBaseID:FBgn0030697 Length:790 Species:Drosophila melanogaster


Alignment Length:341 Identity:84/341 - (24%)
Similarity:136/341 - (39%) Gaps:90/341 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LAYIGEGAYGMVVSAD-DTLTNQRVAIKKISPFEHQTYCQR---TLREITILTRFKHENIIDIRD 101
            |.:|..|..|.::.:| |..|.|...:.::...|::  |.|   .|:...:..|:    ::||  
  Fly   431 LPFIPFGFDGFMMMSDADCRTVQNSKLPEMEGMEYK--CDRINLCLKSPELFLRY----VLDI-- 487

  Fly   102 ILRVDSIDQMRDVYIVQCLMETDLYKLLKTQ-----------------------RLSNDHICYFL 143
               :.::|:                |.|.||                       ||:::    ..
  Fly   488 ---IKNLDE----------------KELSTQDKRRRFTQASGRGQTKKNARSRLRLASN----AA 529

  Fly   144 YQILRGLKYIHSANVLHRDLKPSNLLLNKTCD--LKICDFGLARIADPEHDHTGFLTEYVATRWY 206
            |....|.:.....|:  .|:.|.: ..|..||  :||.|.|.|...   |.|   .|:.:.|:.|
  Fly   530 YTTGTGWRSNRKINL--NDIYPID-PANNECDVRVKIADLGNACYF---HHH---FTDDIQTKEY 585

  Fly   207 RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFP-----GKHYLDQLNHILGVLGSPSRDDLE 266
            ||.|::|.: ||.::.|||||.|:|.|:.:...:|.     ||:.||:: ||..::.:..|....
  Fly   586 RALEVILGA-GYCETADIWSVACLLWELATGTYLFDTHSKRGKYNLDEV-HIAKIVETCGRIPWY 648

  Fly   267 CIINEK-ARNYLESLPFKPNVPWAKLFPNADALA-------------LDLLGKMLTFNPHKRIPV 317
            .|...| :||::.|.....|:...|....|:.|.             ::.|..||..||..||..
  Fly   649 LIRKGKHSRNFINSAGKLCNIETLKPLKLANILIRWYGWRTRQSTEFVNFLMPMLQTNPLSRISA 713

  Fly   318 EEALAHPYLEQYYDPG 333
            .:||...||.....||
  Fly   714 SKALESHYLCNIALPG 729

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 84/341 (25%)
S_TKc 38..326 CDD:214567 80/332 (24%)
CG8565NP_573080.1 PKc_like 192..722 CDD:304357 80/332 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442170
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.