DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rl and XB956263

DIOPT Version :9

Sequence 1:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster
Sequence 2:XP_002938433.1 Gene:XB956263 / 100145045 XenbaseID:XB-GENE-956264 Length:359 Species:Xenopus tropicalis


Alignment Length:346 Identity:153/346 - (44%)
Similarity:220/346 - (63%) Gaps:9/346 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKK-ISPFEHQTYCQRTLREITILTRFKHEN 95
            ::|..||..||.:|.||||.|.||.|.||.:|||||| :.||:...:.:|..||:.:|...||||
 Frog    19 WDVPVRYRDLAAVGSGAYGTVCSAQDRLTGERVAIKKLLRPFQSLVHAKRAYRELRLLKHMKHEN 83

  Fly    96 IIDIRDILRVD-SIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVL 159
            :|.:.::...| |::..:..|:|...:..||.::::.|||::..|.|.||||||||:|||:|.::
 Frog    84 VISLLNVFTPDESMETFQTFYLVMPFIAVDLSRVMRMQRLNHSTIVYLLYQILRGLQYIHAAGIV 148

  Fly   160 HRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI 224
            |||||||||.:|:..:|||.||||||..:.|      :|.||.||||||||::||...|..::||
 Frog   149 HRDLKPSNLGVNEDYELKILDFGLARPTEFE------MTGYVVTRWYRAPEVILNWMHYNHTVDI 207

  Fly   225 WSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNVPWA 289
            ||||||||||::.:.:|||..|.|:||.|:.|.|||....:..:.:..|::|::.||.|....:.
 Frog   208 WSVGCILAEMITGKVLFPGGDYFDELNKIIEVTGSPQPSLINKMESSHAQDYVKMLPKKQKKNFK 272

  Fly   290 KLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVAEVPFRINMENDDISRD 354
            :|||...|:..|||.|||..:|..|:...|||||||||:|.|...:|.|: .:..:.|:.|::..
 Frog   273 ELFPTMSAVETDLLEKMLDLDPGTRVNATEALAHPYLEEYNDSDPDPTAD-KYDDSFESLDLNVH 336

  Fly   355 ALKSLIFEETLKFKERQPDNA 375
            ..|||...|.:.|:..:|..|
 Frog   337 EWKSLSHMEIMTFEPMKPSQA 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 150/335 (45%)
S_TKc 38..326 CDD:214567 135/289 (47%)
XB956263XP_002938433.1 STKc_p38 9..351 CDD:143356 151/338 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.