DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and KBTBD11

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_055682.1 Gene:KBTBD11 / 9920 HGNCID:29104 Length:623 Species:Homo sapiens


Alignment Length:485 Identity:96/485 - (19%)
Similarity:160/485 - (32%) Gaps:128/485 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DAQISVGEDVFNVHRAIMCSCSSYFRAQFTGFNADTPGCVDGSDAKKNNNFIHIPGVSSCIMNCV 147
            |..:.|.......|:|::.:.|.|||                  |:.:.:.:.:.|||...:..:
Human   141 DLVLEVSGRRLRAHKAVLAARSDYFR------------------ARASRDVLRVQGVSLTALRLL 187

  Fly   148 IQYAYL-RQTNISESNVHELLICADYVGMVGLVKKCKDYLGRILTPENCVSIMGFARFRFLEDLH 211
            :..||. |...:...||.|::..|..:.:.|..::..|.:|..|:..||..::..|:.:.|.:|.
Human   188 LADAYSGRMAGVRPDNVAEVVAGARRLQLPGAAQRATDAVGPQLSLANCYEVLSAAKRQRLNELR 252

  Fly   212 LKARNYTLRYFTEVAYRNIDILDMSAEDFYSIISDDELNTREEDHVWKLCVKWIDRNPESRKR-- 274
            ..|                          |..:||..|....|..|:.. :...:|:...|:|  
Human   253 DAA--------------------------YCFMSDHYLEVLREPAVFGR-LSGAERDLLLRRRLR 290

  Fly   275 -HVAHLMTGVRLGLMTPKCFMEEVKEHPYVLECEAAKPLIVDTFKFMYDLDFLNPQADELTTPPL 338
             ..|||:...                                          |.|..:...    
Human   291 AGRAHLLAAA------------------------------------------LGPAGERAG---- 309

  Fly   339 AMPRLPHEVIFAIGGWSGGTSKGCIETYDTRADRWVTINAEDPAGPRAYHGTAVLGFKIFSIGGY 403
            :.|:.|       .|.:.......:..:...|..|..:.......|....|..||...:|..||.
Human   310 SRPQSP-------SGDADARGDAAVYCFHAAAGEWRELTRLPEGAPARGCGLCVLYNYLFVAGGV 367

  Fly   404 DGVEYFNTCRVFDAV------KKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERY 462
            .........|..|.|      ...|:.:.|:...|..:.:..|:|.:||:||    ..|.:||||
Human   368 APAGPDGRARPSDQVFCYNPATDSWSAVRPLRQARSQLRLLALDGHLYAVGG----ECLLSVERY 428

  Fly   463 NPRTNQWSVIPPMNMQRSDAS--ACTLQERIYATGGFNGQECLDSAEY----YDPVTNVWTRIPN 521
            :||.::|:.:.|:.......:  |.|....||.:||        |..|    |||..:.|...|.
Human   429 DPRADRWAPVAPLPRGAFAVAHEATTCHGEIYVSGG--------SLFYRLLKYDPRRDEWQECPC 485

  Fly   522 MNHRRSGVSCVAFRNQLY--VIGGFNGTAR 549
            .:.|......||....:|  .:.|..|.|:
Human   486 SSSRERSADMVALDGFIYRFDLSGSRGEAQ 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045 21/103 (20%)
PHA03098 86..610 CDD:222983 95/482 (20%)
BACK 195..298 CDD:285009 17/105 (16%)
Kelch 347..394 CDD:128874 6/46 (13%)
KELCH repeat 385..428 CDD:276965 10/48 (21%)
Kelch 396..442 CDD:128874 10/51 (20%)
Kelch_1 431..476 CDD:279660 16/44 (36%)
KELCH repeat 432..475 CDD:276965 15/42 (36%)
KELCH repeat 479..523 CDD:276965 13/49 (27%)
Kelch 490..536 CDD:128874 14/49 (29%)
Kelch_1 525..570 CDD:279660 7/27 (26%)
KELCH repeat 526..571 CDD:276965 6/26 (23%)
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
KBTBD11NP_055682.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..129
DUF719 54..>136 CDD:283086
BTB 141..226 CDD:197585 20/102 (20%)
BTB 141..225 CDD:279045 20/101 (20%)
Kelch 1 311..359 9/54 (17%)
Kelch_1 348..399 CDD:279660 12/50 (24%)
KELCH repeat 350..398 CDD:276965 10/47 (21%)
Kelch 2 360..412 10/51 (20%)
KELCH repeat 402..442 CDD:276965 16/43 (37%)
Kelch 3 413..455 14/45 (31%)
Kelch 413..449 CDD:128874 13/39 (33%)
Kelch_1 450..484 CDD:279660 12/41 (29%)
Kelch 4 458..500 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.