| Sequence 1: | NP_001015100.2 | Gene: | klhl10 / 3354863 | FlyBaseID: | FBgn0040038 | Length: | 767 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_174062.1 | Gene: | AT1G27420 / 839632 | AraportID: | AT1G27420 | Length: | 346 | Species: | Arabidopsis thaliana |
| Alignment Length: | 196 | Identity: | 67/196 - (34%) |
|---|---|---|---|
| Similarity: | 91/196 - (46%) | Gaps: | 27/196 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 383 GP--RAYHGTAVL-GFKIFSIGGYDGVE--YFNTCRV--------FDAVKKKWNEIAPMHCRRCY 434
Fly 435 VSVTELNGMIYAIGGY--DGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGF 497
Fly 498 NGQECLDSAEYYDPVTNVWTRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQT 562
Fly 563 W 563 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| klhl10 | NP_001015100.2 | BTB | 72..186 | CDD:279045 | |
| PHA03098 | 86..610 | CDD:222983 | 67/196 (34%) | ||
| BACK | 195..298 | CDD:285009 | |||
| Kelch | 347..394 | CDD:128874 | 7/13 (54%) | ||
| KELCH repeat | 385..428 | CDD:276965 | 19/53 (36%) | ||
| Kelch | 396..442 | CDD:128874 | 16/55 (29%) | ||
| Kelch_1 | 431..476 | CDD:279660 | 19/46 (41%) | ||
| KELCH repeat | 432..475 | CDD:276965 | 19/44 (43%) | ||
| KELCH repeat | 479..523 | CDD:276965 | 13/43 (30%) | ||
| Kelch | 490..536 | CDD:128874 | 14/45 (31%) | ||
| Kelch_1 | 525..570 | CDD:279660 | 12/39 (31%) | ||
| KELCH repeat | 526..571 | CDD:276965 | 12/38 (32%) | ||
| Kelch_1 | 573..617 | CDD:279660 | |||
| KELCH repeat | 573..617 | CDD:276965 | |||
| AT1G27420 | NP_174062.1 | F-box | 9..50 | CDD:395521 | |
| PHA03098 | <81..286 | CDD:222983 | 67/196 (34%) | ||
| KELCH repeat | 100..153 | CDD:276965 | 19/53 (36%) | ||
| KELCH repeat | 157..202 | CDD:276965 | 19/45 (42%) | ||
| KELCH repeat | 205..242 | CDD:276965 | 12/42 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 57 | 1.000 | Inparanoid score | I2576 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X9 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.860 | |||||