DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT1G15670

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_563979.1 Gene:AT1G15670 / 838136 AraportID:AT1G15670 Length:359 Species:Arabidopsis thaliana


Alignment Length:199 Identity:54/199 - (27%)
Similarity:79/199 - (39%) Gaps:30/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 PAGPRAYHGTAVLGFK-IFSIGGYDGVEYFN---TCRVFDAVKKKWNEIAPMHCRRCYVSVTELN 441
            |.|||::...|....: :|..||:|  |..|   :..|:|..:.:|..:..|...|...:.....
plant   154 PGGPRSFFACASDSQRNVFVAGGHD--EDKNAMMSALVYDVAEDRWAFLPDMGRERDECTAIFHA 216

  Fly   442 GMIYAIGGYDGHNR---LNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQ--E 501
            |..:.||||....:   ..|.|.::..|.:||   |.. :...:|..|:...|.|.|. ||.  .
plant   217 GKFHVIGGYSTEEQGQFSKTAESFDVTTWRWS---PQG-EEFLSSEMTMWPPICAAGE-NGDLYA 276

  Fly   502 CL--DSAEYYDPVTNVWTRIPNMNHRRSGVSCVAFR--NQLYVIGGFNGTARL---STGERFDPD 559
            |.  |.....|   :.|.::.|:......||.||.|  ..|.||    |:||.   |.|..:|..
plant   277 CCRRDLMMMKD---DTWYKVGNLPADVCNVSYVAIRRSGNLVVI----GSARYGEPSVGYNWDMS 334

  Fly   560 TQTW 563
            ...|
plant   335 NSRW 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 54/199 (27%)
KELCH repeat 385..428 CDD:276965 11/46 (24%)
KELCH repeat 432..475 CDD:276965 11/45 (24%)
KELCH repeat 479..523 CDD:276965 12/47 (26%)
KELCH repeat 526..571 CDD:276965 15/43 (35%)
KELCH repeat 573..617 CDD:276965
AT1G15670NP_563979.1 F-box_SF 3..47 CDD:459239
KELCH repeat 110..153 CDD:276965
NanM 114..>277 CDD:442289 34/129 (26%)
KELCH repeat 158..204 CDD:276965 11/47 (23%)
KELCH repeat 207..249 CDD:276965 11/44 (25%)
KELCH repeat 265..297 CDD:276965 10/35 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.