DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G60570

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001331512.1 Gene:AT5G60570 / 836178 AraportID:AT5G60570 Length:393 Species:Arabidopsis thaliana


Alignment Length:183 Identity:52/183 - (28%)
Similarity:78/183 - (42%) Gaps:28/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   406 VEY--FNTC-----RVFDAVKKKWNEIAPMHCRRCY-------VSV-TELNGMIYAIGGYDGHNR 455
            |||  |..|     .:|..:||||..:..|.|..|:       ::| .||  :::      |...
plant    99 VEYLVFMVCDPRGWLMFSPMKKKWMVLPKMPCDECFNHADKESLAVDDEL--LVF------GREL 155

  Fly   456 LN-TVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGG--FNGQECLDSAEYYDPVTNVWT 517
            .. .:.:|:.|:..|.....|:..|...::.:|.......||  .|| ..|.|||.||..:..|.
plant   156 FQFAIWKYSLRSRCWVKCEGMHRPRCLFASGSLGGIAIVAGGTDMNG-NILASAELYDSSSGRWE 219

  Fly   518 RIPNMNHRRSGVSCVAFRNQLYVIGGFNG-TARLSTGERFDPDTQTWHFIREM 569
            .:|||:..|...|......:.|||||.:. ...::.||.||.:|:.|..|..|
plant   220 MLPNMHSPRRLCSGFFMDGKFYVIGGMSSPNVSVTFGEEFDLETRKWRKIEGM 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 52/183 (28%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874
KELCH repeat 385..428 CDD:276965 10/28 (36%)
Kelch 396..442 CDD:128874 16/50 (32%)
Kelch_1 431..476 CDD:279660 8/53 (15%)
KELCH repeat 432..475 CDD:276965 8/51 (16%)
KELCH repeat 479..523 CDD:276965 15/45 (33%)
Kelch 490..536 CDD:128874 16/47 (34%)
Kelch_1 525..570 CDD:279660 15/46 (33%)
KELCH repeat 526..571 CDD:276965 15/45 (33%)
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT5G60570NP_001331512.1 F-box 50..93 CDD:366220
PHA03098 <120..325 CDD:222983 45/162 (28%)
KELCH repeat 180..225 CDD:276965 15/45 (33%)
KELCH repeat 228..272 CDD:276965 14/43 (33%)
KELCH repeat 278..320 CDD:276965
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2576
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.