DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G49000

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001119398.1 Gene:AT5G49000 / 834959 AraportID:AT5G49000 Length:372 Species:Arabidopsis thaliana


Alignment Length:288 Identity:59/288 - (20%)
Similarity:96/288 - (33%) Gaps:83/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 IFAIGGWSGGTSKGCIETYDTRADRWVTINAEDPA--GPRAYHGTAVLGFKIFSIGGYDGVEYFN 410
            |:||||.........:...|.|:..|    .|.|:  ..|.|....|:..||:..||.:..:...
plant   132 IYAIGGSIENAPSSKVSILDCRSHTW----HEAPSMRMKRNYPAANVVDGKIYVAGGLEEFDSSK 192

  Fly   411 TCRVFDAVKKKWN-EIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVI-- 472
            ...|||...:.|. .::|:..|..|.|:. :.|.||..|        :.|..|.|:.::|..:  
plant   193 WMEVFDIKTQTWEFVLSPLAERFIYRSLV-IEGEIYIFG--------DKVVTYKPKEDRWGGVGE 248

  Fly   473 -PPMNMQRSDASACTLQERIYA--TGGFNGQE---------------------CLDSAEYYDPVT 513
             ..|::.....|.|.:...:|.  .||....|                     |:..|:|...:.
plant   249 HQSMDLGLFFHSYCVIDNVLYCYRPGGIKWYESEKRSWRKLRGLKGLSKLASSCVKLADYGGKMA 313

  Fly   514 NVWTR-IPNMNHRRSGVSCVAF-----RNQLYVIGGFNGTARLSTGERFDPDTQTWHFIREMNHS 572
            .:|.: ||...::...:||...     :||     |..|.                         
plant   314 LLWDKYIPCSGNKSHSISCAVVSLERCKNQ-----GIRGK------------------------- 348

  Fly   573 RSNFGLEIIDDMIFAIGGFNGVSTISHT 600
                 :|..|||:.....:|.|..::.|
plant   349 -----VEWFDDMLTVPSSYNFVGALAAT 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 59/288 (20%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 13/47 (28%)
KELCH repeat 385..428 CDD:276965 11/43 (26%)
Kelch 396..442 CDD:128874 12/46 (26%)
Kelch_1 431..476 CDD:279660 11/47 (23%)
KELCH repeat 432..475 CDD:276965 10/45 (22%)
KELCH repeat 479..523 CDD:276965 12/67 (18%)
Kelch 490..536 CDD:128874 12/74 (16%)
Kelch_1 525..570 CDD:279660 6/49 (12%)
KELCH repeat 526..571 CDD:276965 6/49 (12%)
Kelch_1 573..617 CDD:279660 7/28 (25%)
KELCH repeat 573..617 CDD:276965 7/28 (25%)
AT5G49000NP_001119398.1 F-box 24..66 CDD:279040
KELCH repeat 121..163 CDD:276965 10/34 (29%)
Kelch 132..177 CDD:128874 13/48 (27%)
KELCH repeat 167..212 CDD:276965 12/44 (27%)
Kelch_1 167..207 CDD:279660 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.