DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G39560

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_198772.2 Gene:AT5G39560 / 833952 AraportID:AT5G39560 Length:403 Species:Arabidopsis thaliana


Alignment Length:317 Identity:65/317 - (20%)
Similarity:106/317 - (33%) Gaps:103/317 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 LTTPPLAMPRLPHEVI----FAIGGWSG--------------------------GTSKG----CI 363
            |::.|.::..||:|:|    ..|..||.                          ||::.    |:
plant    22 LSSEPPSLMSLPYEIIENILARISKWSYPNLSLVSKSFLSLLSSPQLYKTRSEIGTTEPCLYFCL 86

  Fly   364 ETYDTRADRWVTI---NAEDPAGPRAYHGTAVLGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEI 425
            |:.:..:.:|.|:   ..|...|....|..:::..                              
plant    87 ESANHSSPQWYTLWMKPDETLTGTGTIHDYSLIPL------------------------------ 121

  Fly   426 APMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQER 490
             |........|...:...||.|||:  .||.::|..::.|:|.|...|.|.:.|||..|..:.:|
plant   122 -PSSSPVLRTSTVAVGSEIYVIGGH--FNRSSSVRIFDCRSNTWRDGPNMTVARSDPVAVLIDQR 183

  Fly   491 IYATGGFNGQECLDSAEYYDPVTNVWTRI---------------PNMNHRRSGVSCVAFR----- 535
            ||..||....|..|..|.:|..|..|..:               ||....|.|.|..|.|     
plant   184 IYVLGGREMDESDDWFEVFDIKTQTWRALPSFRAGLELRRYIVWPNRYFPRLGDSQTAVRLINVN 248

  Fly   536 -----NQLYVIGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLEIIDDMIFA 587
                 .:|||....|...       ::|...||..:.:.:..|..... :|:::::|
plant   249 PNALEGKLYVAAQINDYT-------YEPKDDTWKVVSKSSIRRVKVWC-VIENVMYA 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 65/317 (21%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 13/83 (16%)
KELCH repeat 385..428 CDD:276965 1/42 (2%)
Kelch 396..442 CDD:128874 2/45 (4%)
Kelch_1 431..476 CDD:279660 13/44 (30%)
KELCH repeat 432..475 CDD:276965 13/42 (31%)
KELCH repeat 479..523 CDD:276965 17/58 (29%)
Kelch 490..536 CDD:128874 18/70 (26%)
Kelch_1 525..570 CDD:279660 12/54 (22%)
KELCH repeat 526..571 CDD:276965 12/54 (22%)
Kelch_1 573..617 CDD:279660 3/15 (20%)
KELCH repeat 573..617 CDD:276965 3/15 (20%)
AT5G39560NP_198772.2 KELCH repeat 131..168 CDD:276965 13/38 (34%)
Kelch 139..181 CDD:128874 17/43 (40%)
Kelch_1 171..216 CDD:279660 15/44 (34%)
KELCH repeat 172..220 CDD:276965 15/47 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.