DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G38680

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_198684.1 Gene:AT5G38680 / 833858 AraportID:AT5G38680 Length:357 Species:Arabidopsis thaliana


Alignment Length:210 Identity:46/210 - (21%)
Similarity:79/210 - (37%) Gaps:35/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 PRAYHGTAV--LGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYA 446
            ||....:::  :|..|::||  ..:..:::..:||.....|.|...:......||...|:|.||.
plant   117 PRLVQRSSLVAVGSNIYNIG--RSISPYSSVSIFDCRSHTWREAPSLPVELVEVSAGVLDGKIYV 179

  Fly   447 IGGY---DGHNRLNTVERYNPRTNQWSVIP-PMNMQRSDASACTLQERIYATGGFNGQECLDSAE 507
            .|..   |..|..||.|.::.:|..|..:| |.|..:.:..:.:|              |:|...
plant   180 AGSCKDGDSLNLKNTFEVFDTKTQVWDHVPIPYNETKHNIYSKSL--------------CIDEKW 230

  Fly   508 Y---------YDPVTNVWTRIPN-MNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQT 562
            |         |:|...:|..:.: |...:|........|.||.:   ..|.|.:....:|.:...
plant   231 YVGAKRKVVSYNPKKGIWDLVESEMCSYKSSYDYCEIENVLYSV---EKTWRGTVFRWYDTELGR 292

  Fly   563 WHFIREMNHSRSNFG 577
            |..:..:|...|..|
plant   293 WRKLEGLNMPYSGTG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 46/210 (22%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 2/11 (18%)
KELCH repeat 385..428 CDD:276965 9/44 (20%)
Kelch 396..442 CDD:128874 10/45 (22%)
Kelch_1 431..476 CDD:279660 16/48 (33%)
KELCH repeat 432..475 CDD:276965 15/46 (33%)
KELCH repeat 479..523 CDD:276965 7/53 (13%)
Kelch 490..536 CDD:128874 8/55 (15%)
Kelch_1 525..570 CDD:279660 8/44 (18%)
KELCH repeat 526..571 CDD:276965 8/44 (18%)
Kelch_1 573..617 CDD:279660 2/5 (40%)
KELCH repeat 573..617 CDD:276965 2/5 (40%)
AT5G38680NP_198684.1 F-box 18..61 CDD:366220
Kelch_1 122..162 CDD:366584 8/41 (20%)
KELCH repeat 124..161 CDD:276965 8/38 (21%)
KELCH repeat 165..209 CDD:276965 14/43 (33%)
Kelch_1 168..209 CDD:366584 14/40 (35%)
KELCH repeat 216..256 CDD:276965 7/53 (13%)
KELCH repeat 259..301 CDD:276965 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.