DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G38680

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_198684.1 Gene:AT5G38680 / 833858 AraportID:AT5G38680 Length:357 Species:Arabidopsis thaliana


Alignment Length:210 Identity:46/210 - (21%)
Similarity:79/210 - (37%) Gaps:35/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 PRAYHGTAV--LGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYA 446
            ||....:::  :|..|::||  ..:..:::..:||.....|.|...:......||...|:|.||.
plant   117 PRLVQRSSLVAVGSNIYNIG--RSISPYSSVSIFDCRSHTWREAPSLPVELVEVSAGVLDGKIYV 179

  Fly   447 IGGY---DGHNRLNTVERYNPRTNQWSVIP-PMNMQRSDASACTLQERIYATGGFNGQECLDSAE 507
            .|..   |..|..||.|.::.:|..|..:| |.|..:.:..:.:|              |:|...
plant   180 AGSCKDGDSLNLKNTFEVFDTKTQVWDHVPIPYNETKHNIYSKSL--------------CIDEKW 230

  Fly   508 Y---------YDPVTNVWTRIPN-MNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQT 562
            |         |:|...:|..:.: |...:|........|.||.:   ..|.|.:....:|.:...
plant   231 YVGAKRKVVSYNPKKGIWDLVESEMCSYKSSYDYCEIENVLYSV---EKTWRGTVFRWYDTELGR 292

  Fly   563 WHFIREMNHSRSNFG 577
            |..:..:|...|..|
plant   293 WRKLEGLNMPYSGTG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 46/210 (22%)
KELCH repeat 385..428 CDD:276965 9/44 (20%)
KELCH repeat 432..475 CDD:276965 15/46 (33%)
KELCH repeat 479..523 CDD:276965 7/53 (13%)
KELCH repeat 526..571 CDD:276965 8/44 (18%)
KELCH repeat 573..617 CDD:276965 2/5 (40%)
AT5G38680NP_198684.1 F-box_AtAFR-like 17..59 CDD:438923
NanM 113..307 CDD:442289 45/208 (22%)
KELCH repeat 124..161 CDD:276965 8/38 (21%)
KELCH repeat 165..209 CDD:276965 14/43 (33%)
KELCH repeat 216..256 CDD:276965 7/53 (13%)
KELCH repeat 259..301 CDD:276965 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.